Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UAL2

Protein Details
Accession A0A1Y2UAL2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-69SEKAADGTRRRRRRKPEPAVVKDGIBasic
NLS Segment(s)
PositionSequence
53-60RRRRRRKP
Subcellular Location(s) mito 11, plas 6, cyto_mito 6, extr 4
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVAASFFVVALPHILPCPAPRVTYADSEKAADGTRRRRRRKPEPAVVKDGIVQFESPSEDFERITAETRGAATRARRERECPVPKPGGVIGELMGFNTSKANEEKREPNDNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.12
24 0.12
25 0.13
26 0.18
27 0.2
28 0.26
29 0.29
30 0.27
31 0.27
32 0.27
33 0.26
34 0.21
35 0.2
36 0.18
37 0.2
38 0.28
39 0.37
40 0.46
41 0.55
42 0.62
43 0.71
44 0.78
45 0.84
46 0.84
47 0.84
48 0.85
49 0.83
50 0.81
51 0.72
52 0.61
53 0.52
54 0.42
55 0.32
56 0.22
57 0.16
58 0.09
59 0.09
60 0.1
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.11
68 0.1
69 0.12
70 0.11
71 0.1
72 0.1
73 0.11
74 0.12
75 0.11
76 0.13
77 0.15
78 0.24
79 0.31
80 0.36
81 0.38
82 0.42
83 0.48
84 0.56
85 0.61
86 0.56
87 0.56
88 0.55
89 0.53
90 0.52
91 0.46
92 0.37
93 0.29
94 0.25
95 0.17
96 0.15
97 0.15
98 0.12
99 0.11
100 0.09
101 0.09
102 0.1
103 0.1
104 0.11
105 0.16
106 0.22
107 0.26
108 0.33
109 0.42
110 0.46