Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UVH2

Protein Details
Accession A0A1Y2UVH2    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-43RDDAKSARIKKNKKSSQTKFKVRCSKHHydrophilic
62-82LPPNLSIKEVPKKNKKGKHTAHydrophilic
NLS Segment(s)
PositionSequence
23-30ARIKKNKK
71-80VPKKNKKGKH
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKKFIEICRRDDAKSARIKKNKKSSQTKFKVRCSKHLYTLILKDSDKAEKLKQSLPPNLSIKEVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.42
4 0.39
5 0.46
6 0.48
7 0.46
8 0.53
9 0.57
10 0.57
11 0.63
12 0.7
13 0.72
14 0.78
15 0.79
16 0.79
17 0.81
18 0.81
19 0.84
20 0.86
21 0.87
22 0.83
23 0.85
24 0.84
25 0.76
26 0.76
27 0.73
28 0.66
29 0.62
30 0.6
31 0.53
32 0.47
33 0.48
34 0.41
35 0.35
36 0.31
37 0.26
38 0.23
39 0.23
40 0.21
41 0.21
42 0.22
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.46
49 0.46
50 0.5
51 0.49
52 0.47
53 0.45
54 0.41
55 0.41
56 0.43
57 0.49
58 0.51
59 0.58
60 0.67
61 0.74
62 0.8