Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UYX8

Protein Details
Accession A0A1Y2UYX8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-86TSTSSSCPCKNRHRAQRKRAKHydrophilic
NLS Segment(s)
PositionSequence
77-86RHRAQRKRAK
Subcellular Location(s) mito 11, golg 7, extr 6, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLPNRYSRARASQVIATVLVAITMSLISFHIINSTRPKTSYQRSNGAIDELTWANLVEFSIKTETSTSSSCPCKNRHRAQRKRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.33
4 0.25
5 0.19
6 0.15
7 0.11
8 0.07
9 0.05
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.04
18 0.07
19 0.09
20 0.11
21 0.18
22 0.21
23 0.21
24 0.22
25 0.26
26 0.29
27 0.35
28 0.42
29 0.39
30 0.43
31 0.45
32 0.46
33 0.42
34 0.37
35 0.3
36 0.21
37 0.19
38 0.13
39 0.11
40 0.09
41 0.08
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.08
48 0.09
49 0.1
50 0.1
51 0.11
52 0.13
53 0.15
54 0.16
55 0.16
56 0.2
57 0.27
58 0.31
59 0.36
60 0.42
61 0.5
62 0.59
63 0.68
64 0.73
65 0.79
66 0.85