Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZE86

Protein Details
Accession H8ZE86   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36TFQTEEREKKRKRVKAKRTRQEDRVLVBasic
NLS Segment(s)
PositionSequence
16-29REKKRKRVKAKRTR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVVQEVRNETFQTEEREKKRKRVKAKRTRQEDRVLVEPALAPKNVRISEYISNSTNVKHKIYRDILINRRNGERVTVLNQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.54
4 0.58
5 0.64
6 0.71
7 0.73
8 0.77
9 0.79
10 0.83
11 0.84
12 0.91
13 0.91
14 0.91
15 0.9
16 0.85
17 0.82
18 0.75
19 0.67
20 0.6
21 0.51
22 0.41
23 0.33
24 0.28
25 0.21
26 0.18
27 0.15
28 0.11
29 0.1
30 0.15
31 0.15
32 0.15
33 0.13
34 0.16
35 0.22
36 0.25
37 0.27
38 0.23
39 0.24
40 0.24
41 0.25
42 0.26
43 0.24
44 0.24
45 0.25
46 0.26
47 0.34
48 0.37
49 0.39
50 0.41
51 0.48
52 0.54
53 0.56
54 0.59
55 0.54
56 0.53
57 0.53
58 0.45
59 0.4
60 0.34
61 0.32
62 0.31