Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZBJ7

Protein Details
Accession H8ZBJ7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-44GASEKKKKKANHMSKSQYNFRHydrophilic
NLS Segment(s)
PositionSequence
10-34KKIVPAGKAPAKGVGASEKKKKKAN
Subcellular Location(s) mito 12.5, mito_nucl 9.833, cyto 8.5, cyto_nucl 7.833, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MKMDAKTGDKKIVPAGKAPAKGVGASEKKKKKANHMSKSQYNFRSSIKRMLKNTYQAAPPQVSGPVVESLCNIVCDIIDKLSHDCEILARKVGKQTINLEEVMAAVQVNLSGELRTHALKEIKEAVAKVPSRSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.43
4 0.44
5 0.43
6 0.39
7 0.33
8 0.32
9 0.29
10 0.3
11 0.31
12 0.35
13 0.44
14 0.48
15 0.54
16 0.61
17 0.64
18 0.66
19 0.7
20 0.74
21 0.74
22 0.77
23 0.8
24 0.8
25 0.82
26 0.79
27 0.73
28 0.64
29 0.57
30 0.5
31 0.5
32 0.44
33 0.48
34 0.48
35 0.5
36 0.5
37 0.54
38 0.55
39 0.53
40 0.53
41 0.47
42 0.4
43 0.35
44 0.35
45 0.29
46 0.24
47 0.18
48 0.16
49 0.12
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.08
56 0.09
57 0.09
58 0.09
59 0.07
60 0.05
61 0.05
62 0.06
63 0.07
64 0.06
65 0.06
66 0.07
67 0.08
68 0.09
69 0.1
70 0.08
71 0.08
72 0.09
73 0.13
74 0.13
75 0.16
76 0.16
77 0.17
78 0.21
79 0.25
80 0.25
81 0.26
82 0.29
83 0.3
84 0.31
85 0.3
86 0.26
87 0.21
88 0.2
89 0.16
90 0.11
91 0.06
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.07
101 0.09
102 0.1
103 0.11
104 0.16
105 0.2
106 0.2
107 0.24
108 0.29
109 0.3
110 0.32
111 0.31
112 0.29
113 0.33
114 0.35
115 0.33