Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UCU3

Protein Details
Accession A0A1Y2UCU3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-30MTTPRSKFSKPRNRISRWDFLAHydrophilic
NLS Segment(s)
PositionSequence
89-99WEKKGRGLKRK
Subcellular Location(s) mito 12, nucl 3, cyto 3, plas 3, cyto_nucl 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024312  TACC_fungi  
Pfam View protein in Pfam  
PF12709  Fungal_TACC  
Amino Acid Sequences MDTLGYSGMTTPRSKFSKPRNRISRWDFLANDVIDVLVICCAWLQDVQILAEFMERHEVQGTFCDLHALYKSKYETKVAALKKSYENRWEKKGRGLKRKVDQLENGKLRLGDARGVIVDFTIRGDLTVTYSLEKNGRECAWPQGCPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.49
4 0.58
5 0.64
6 0.73
7 0.75
8 0.78
9 0.84
10 0.82
11 0.8
12 0.75
13 0.73
14 0.62
15 0.55
16 0.54
17 0.44
18 0.37
19 0.27
20 0.21
21 0.14
22 0.13
23 0.1
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.07
38 0.08
39 0.08
40 0.06
41 0.11
42 0.1
43 0.11
44 0.12
45 0.13
46 0.11
47 0.13
48 0.15
49 0.1
50 0.1
51 0.11
52 0.09
53 0.1
54 0.12
55 0.13
56 0.11
57 0.14
58 0.16
59 0.18
60 0.19
61 0.2
62 0.19
63 0.2
64 0.27
65 0.26
66 0.28
67 0.27
68 0.28
69 0.33
70 0.37
71 0.36
72 0.38
73 0.45
74 0.44
75 0.52
76 0.55
77 0.51
78 0.55
79 0.6
80 0.61
81 0.63
82 0.67
83 0.67
84 0.69
85 0.77
86 0.72
87 0.68
88 0.66
89 0.63
90 0.65
91 0.59
92 0.52
93 0.44
94 0.39
95 0.35
96 0.31
97 0.24
98 0.16
99 0.14
100 0.14
101 0.13
102 0.13
103 0.13
104 0.09
105 0.09
106 0.06
107 0.07
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.1
114 0.12
115 0.12
116 0.13
117 0.14
118 0.17
119 0.2
120 0.21
121 0.2
122 0.23
123 0.24
124 0.25
125 0.26
126 0.34
127 0.36
128 0.35