Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZDV4

Protein Details
Accession H8ZDV4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RSKGYRSKTRSVFKKDYDQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036948  Ribosomal_L21_sf  
IPR001147  Ribosomal_L21e  
IPR018259  Ribosomal_L21e_CS  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01157  Ribosomal_L21e  
PROSITE View protein in PROSITE  
PS01171  RIBOSOMAL_L21E  
Amino Acid Sequences MRSKGYRSKTRSVFKKDYDQSKRPQTTTLLNQYKRGDYVDISVDSGVHKGMPHRTFVGKTGRVYAVFKTSVGIALTKQCGNSLVVKKVIARIEHVRPSQCQKEKIARDEYRAKHGVAPPKPLPEGARPAFTISLESNTPVVLKSNSHFAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.78
4 0.8
5 0.79
6 0.76
7 0.75
8 0.77
9 0.77
10 0.68
11 0.63
12 0.56
13 0.55
14 0.56
15 0.58
16 0.57
17 0.52
18 0.57
19 0.56
20 0.54
21 0.47
22 0.4
23 0.31
24 0.22
25 0.23
26 0.21
27 0.19
28 0.17
29 0.16
30 0.14
31 0.13
32 0.12
33 0.1
34 0.06
35 0.06
36 0.09
37 0.17
38 0.17
39 0.19
40 0.21
41 0.24
42 0.24
43 0.28
44 0.33
45 0.29
46 0.28
47 0.3
48 0.29
49 0.28
50 0.28
51 0.25
52 0.2
53 0.17
54 0.16
55 0.13
56 0.12
57 0.11
58 0.1
59 0.1
60 0.07
61 0.08
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.11
68 0.16
69 0.18
70 0.19
71 0.19
72 0.2
73 0.2
74 0.24
75 0.25
76 0.19
77 0.2
78 0.23
79 0.27
80 0.33
81 0.35
82 0.33
83 0.33
84 0.39
85 0.44
86 0.45
87 0.43
88 0.42
89 0.49
90 0.54
91 0.57
92 0.61
93 0.54
94 0.55
95 0.61
96 0.58
97 0.57
98 0.53
99 0.47
100 0.43
101 0.45
102 0.48
103 0.43
104 0.48
105 0.43
106 0.46
107 0.46
108 0.42
109 0.4
110 0.37
111 0.42
112 0.36
113 0.36
114 0.32
115 0.34
116 0.33
117 0.3
118 0.27
119 0.19
120 0.2
121 0.18
122 0.18
123 0.16
124 0.15
125 0.15
126 0.13
127 0.15
128 0.13
129 0.15
130 0.15