Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2V855

Protein Details
Accession A0A1Y2V855   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37DNLKAKLKKVFSKSKKDKSKPADKPAEAHydrophilic
NLS Segment(s)
PositionSequence
13-36KAKLKKVFSKSKKDKSKPADKPAE
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPGVPKDALDNLKAKLKKVFSKSKKDKSKPADKPAEAPKADAAEASKTEAAPAAAPAAAEAPKASDTPASAPTDPAQAAAAAPTEAAKAEAPAAAEPAAAPAAEAKPTEEAKPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.4
4 0.44
5 0.5
6 0.59
7 0.6
8 0.7
9 0.78
10 0.82
11 0.86
12 0.85
13 0.86
14 0.85
15 0.87
16 0.85
17 0.85
18 0.84
19 0.74
20 0.74
21 0.72
22 0.71
23 0.6
24 0.51
25 0.43
26 0.34
27 0.33
28 0.26
29 0.19
30 0.12
31 0.12
32 0.13
33 0.12
34 0.1
35 0.1
36 0.1
37 0.09
38 0.07
39 0.07
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.09
55 0.12
56 0.14
57 0.14
58 0.15
59 0.15
60 0.17
61 0.16
62 0.15
63 0.11
64 0.09
65 0.08
66 0.08
67 0.07
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.07
84 0.08
85 0.08
86 0.06
87 0.06
88 0.08
89 0.09
90 0.11
91 0.11
92 0.11
93 0.16
94 0.18
95 0.2