Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VJ25

Protein Details
Accession A0A1Y2VJ25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-94SHTLHNPYRSTRREKRRMKYSAGYGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, extr 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQACHEVKISVKQKCRCCHLAIVVLGTSLLATAFTFLHRMLIFSLFSSSFLAAEDKTTYYDHNPMTAGWSHTLHNPYRSTRREKRRMKYSAGYGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.65
4 0.61
5 0.6
6 0.56
7 0.55
8 0.47
9 0.42
10 0.34
11 0.3
12 0.25
13 0.18
14 0.13
15 0.06
16 0.05
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.06
23 0.06
24 0.08
25 0.08
26 0.09
27 0.09
28 0.1
29 0.1
30 0.09
31 0.1
32 0.08
33 0.09
34 0.09
35 0.08
36 0.06
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.09
44 0.09
45 0.1
46 0.11
47 0.16
48 0.16
49 0.16
50 0.16
51 0.14
52 0.17
53 0.18
54 0.17
55 0.15
56 0.16
57 0.16
58 0.2
59 0.25
60 0.25
61 0.28
62 0.3
63 0.34
64 0.42
65 0.48
66 0.54
67 0.6
68 0.68
69 0.74
70 0.8
71 0.84
72 0.85
73 0.85
74 0.84
75 0.82