Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZFS2

Protein Details
Accession H8ZFS2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDSKEKKQTKRKQAHQNTFAFRHHydrophilic
40-69GLCRRCTDKIDWRKKYRKYKIQTHVSRCTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MDSKEKKQTKRKQAHQNTFAFRHNPNSSLTKEIAAIKISGLCRRCTDKIDWRKKYRKYKIQTHVSRCTVCLEKSITKAYNIVCEPCGEAKTICRMCKVVLCFETCAPLEQVLAAQKKENTAAPEKNPEEVKTAPSGVTDEQDLVSEEASISDASSCALSEDLVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.9
4 0.86
5 0.8
6 0.75
7 0.67
8 0.58
9 0.56
10 0.49
11 0.42
12 0.38
13 0.38
14 0.35
15 0.35
16 0.34
17 0.26
18 0.26
19 0.27
20 0.25
21 0.21
22 0.19
23 0.15
24 0.18
25 0.19
26 0.22
27 0.21
28 0.21
29 0.24
30 0.3
31 0.32
32 0.32
33 0.37
34 0.43
35 0.52
36 0.61
37 0.67
38 0.71
39 0.78
40 0.83
41 0.88
42 0.88
43 0.87
44 0.84
45 0.86
46 0.85
47 0.87
48 0.86
49 0.83
50 0.81
51 0.75
52 0.67
53 0.57
54 0.5
55 0.42
56 0.33
57 0.28
58 0.23
59 0.22
60 0.23
61 0.27
62 0.24
63 0.21
64 0.24
65 0.21
66 0.22
67 0.2
68 0.19
69 0.15
70 0.14
71 0.15
72 0.14
73 0.14
74 0.09
75 0.09
76 0.09
77 0.18
78 0.21
79 0.21
80 0.21
81 0.21
82 0.21
83 0.26
84 0.26
85 0.23
86 0.21
87 0.22
88 0.22
89 0.22
90 0.24
91 0.2
92 0.19
93 0.15
94 0.13
95 0.11
96 0.09
97 0.11
98 0.13
99 0.15
100 0.14
101 0.16
102 0.16
103 0.18
104 0.19
105 0.21
106 0.2
107 0.24
108 0.29
109 0.3
110 0.39
111 0.38
112 0.41
113 0.41
114 0.38
115 0.35
116 0.32
117 0.31
118 0.24
119 0.25
120 0.2
121 0.19
122 0.2
123 0.16
124 0.16
125 0.15
126 0.13
127 0.12
128 0.12
129 0.13
130 0.11
131 0.1
132 0.09
133 0.08
134 0.07
135 0.08
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.06
143 0.06
144 0.07
145 0.06