Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZFJ7

Protein Details
Accession H8ZFJ7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-38IDFGKKKKLVVHKEKEIKKQEKTKRQDKPIKPTDIDBasic
NLS Segment(s)
PositionSequence
7-31KKKKLVVHKEKEIKKQEKTKRQDKP
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLIDFGKKKKLVVHKEKEIKKQEKTKRQDKPIKPTDIDMLILKSKEALDEDRSIFSHIPYENAEIAIMVDPCTKTHKNTRTLYEQYKEQINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.83
4 0.85
5 0.85
6 0.82
7 0.79
8 0.8
9 0.8
10 0.8
11 0.82
12 0.82
13 0.82
14 0.85
15 0.87
16 0.84
17 0.85
18 0.83
19 0.81
20 0.72
21 0.64
22 0.56
23 0.46
24 0.39
25 0.29
26 0.22
27 0.16
28 0.15
29 0.13
30 0.11
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.13
37 0.15
38 0.15
39 0.15
40 0.17
41 0.16
42 0.14
43 0.15
44 0.12
45 0.13
46 0.14
47 0.16
48 0.14
49 0.14
50 0.14
51 0.1
52 0.1
53 0.1
54 0.09
55 0.07
56 0.09
57 0.09
58 0.1
59 0.17
60 0.19
61 0.22
62 0.32
63 0.4
64 0.47
65 0.53
66 0.59
67 0.61
68 0.67
69 0.7
70 0.64
71 0.61
72 0.56