Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2UY17

Protein Details
Accession A0A1Y2UY17    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-42QLHHHHAHRHRAHRDPMSKRDKIBasic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016787  F:hydrolase activity  
Amino Acid Sequences MRLTTISLTLLSLLHLSAGQLHHHHAHRHRAHRDPMSKRDKITVTDTARSTITEVPEVVVYVDQHNKPIRTVTETVVYVPASVETQKAPAAPTTTTTVYAPAVSSKDVLIEHSTSTPSSSSTSTVKHVSTFEPIPSPLPSKSSRTSSYPSASSAPSPPPSPPVSGRGALHGVTYSPYKGAGGCKSAADVEKDFALVAKDYGVIRLYGVDCDQVATAYAAAKKHGNKLFLGIFDIHSVEQAVSTMAAGVNHDWSIVDTVSVGNELVNNGGATLSQSLAALSQARTALRAAGYQGPVVIVDTFVAILAHPELCDQSDYCAANIHPFFDPNTGAHQAGSFVTSMVSKIRSKLADKSKRIVVTETGWPWQGESNGAAVPGMDQQTAALSSIKSAYADNASDVILFTAFNDMWKKPEAATFMAEQFWGMGGRYSPVDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.1
5 0.12
6 0.14
7 0.16
8 0.2
9 0.26
10 0.31
11 0.39
12 0.42
13 0.52
14 0.58
15 0.66
16 0.7
17 0.72
18 0.77
19 0.79
20 0.81
21 0.79
22 0.81
23 0.81
24 0.77
25 0.71
26 0.7
27 0.63
28 0.58
29 0.55
30 0.54
31 0.5
32 0.52
33 0.5
34 0.44
35 0.41
36 0.37
37 0.34
38 0.28
39 0.24
40 0.2
41 0.19
42 0.18
43 0.18
44 0.17
45 0.15
46 0.12
47 0.11
48 0.13
49 0.2
50 0.2
51 0.25
52 0.31
53 0.31
54 0.31
55 0.35
56 0.33
57 0.33
58 0.35
59 0.31
60 0.32
61 0.31
62 0.31
63 0.29
64 0.26
65 0.19
66 0.17
67 0.15
68 0.1
69 0.1
70 0.11
71 0.09
72 0.11
73 0.11
74 0.12
75 0.13
76 0.14
77 0.15
78 0.14
79 0.16
80 0.19
81 0.19
82 0.2
83 0.19
84 0.18
85 0.16
86 0.16
87 0.14
88 0.12
89 0.12
90 0.12
91 0.12
92 0.11
93 0.12
94 0.12
95 0.13
96 0.13
97 0.13
98 0.14
99 0.14
100 0.15
101 0.14
102 0.14
103 0.13
104 0.11
105 0.12
106 0.12
107 0.13
108 0.15
109 0.17
110 0.19
111 0.22
112 0.21
113 0.21
114 0.22
115 0.21
116 0.23
117 0.23
118 0.21
119 0.2
120 0.2
121 0.2
122 0.2
123 0.21
124 0.17
125 0.2
126 0.22
127 0.25
128 0.29
129 0.32
130 0.33
131 0.35
132 0.38
133 0.39
134 0.4
135 0.35
136 0.33
137 0.3
138 0.28
139 0.25
140 0.24
141 0.23
142 0.21
143 0.21
144 0.2
145 0.22
146 0.23
147 0.24
148 0.23
149 0.24
150 0.25
151 0.26
152 0.26
153 0.24
154 0.24
155 0.21
156 0.19
157 0.14
158 0.11
159 0.1
160 0.1
161 0.08
162 0.07
163 0.07
164 0.07
165 0.08
166 0.11
167 0.12
168 0.14
169 0.14
170 0.14
171 0.14
172 0.15
173 0.15
174 0.14
175 0.13
176 0.11
177 0.11
178 0.11
179 0.1
180 0.09
181 0.08
182 0.06
183 0.05
184 0.05
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.06
191 0.08
192 0.08
193 0.07
194 0.07
195 0.07
196 0.06
197 0.07
198 0.06
199 0.05
200 0.05
201 0.05
202 0.05
203 0.06
204 0.08
205 0.07
206 0.09
207 0.12
208 0.13
209 0.21
210 0.24
211 0.24
212 0.22
213 0.25
214 0.26
215 0.23
216 0.23
217 0.16
218 0.13
219 0.12
220 0.13
221 0.09
222 0.08
223 0.08
224 0.06
225 0.05
226 0.05
227 0.04
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.06
265 0.07
266 0.06
267 0.08
268 0.09
269 0.09
270 0.1
271 0.1
272 0.11
273 0.1
274 0.11
275 0.11
276 0.14
277 0.15
278 0.14
279 0.14
280 0.12
281 0.11
282 0.12
283 0.09
284 0.05
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.03
291 0.04
292 0.05
293 0.05
294 0.05
295 0.06
296 0.06
297 0.07
298 0.09
299 0.08
300 0.09
301 0.14
302 0.15
303 0.15
304 0.17
305 0.16
306 0.21
307 0.21
308 0.21
309 0.17
310 0.17
311 0.19
312 0.18
313 0.19
314 0.14
315 0.19
316 0.19
317 0.19
318 0.18
319 0.17
320 0.16
321 0.15
322 0.15
323 0.09
324 0.07
325 0.07
326 0.07
327 0.08
328 0.09
329 0.13
330 0.13
331 0.15
332 0.21
333 0.24
334 0.28
335 0.36
336 0.45
337 0.52
338 0.55
339 0.59
340 0.6
341 0.6
342 0.58
343 0.52
344 0.44
345 0.38
346 0.41
347 0.38
348 0.33
349 0.31
350 0.29
351 0.27
352 0.26
353 0.23
354 0.17
355 0.15
356 0.15
357 0.13
358 0.13
359 0.12
360 0.09
361 0.1
362 0.12
363 0.12
364 0.1
365 0.1
366 0.1
367 0.11
368 0.12
369 0.12
370 0.1
371 0.09
372 0.1
373 0.12
374 0.12
375 0.11
376 0.11
377 0.13
378 0.15
379 0.15
380 0.15
381 0.15
382 0.15
383 0.14
384 0.14
385 0.12
386 0.08
387 0.08
388 0.07
389 0.1
390 0.1
391 0.13
392 0.17
393 0.17
394 0.2
395 0.23
396 0.24
397 0.22
398 0.26
399 0.27
400 0.26
401 0.29
402 0.29
403 0.28
404 0.27
405 0.25
406 0.21
407 0.17
408 0.15
409 0.13
410 0.1
411 0.1
412 0.1
413 0.12