Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2V8K1

Protein Details
Accession A0A1Y2V8K1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79DNNARAKKVRHSQSRPPYSGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MKFSLVFAFWLTVAFGQQFPECTRELAETDDCADVINANACYNQFRFRDNQTLSCIGGTDNNARAKKVRHSQSRPPYSGLANGIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.12
6 0.13
7 0.15
8 0.15
9 0.15
10 0.16
11 0.15
12 0.16
13 0.17
14 0.16
15 0.14
16 0.15
17 0.14
18 0.13
19 0.11
20 0.1
21 0.07
22 0.06
23 0.08
24 0.06
25 0.06
26 0.07
27 0.07
28 0.09
29 0.1
30 0.15
31 0.14
32 0.15
33 0.18
34 0.22
35 0.3
36 0.3
37 0.33
38 0.31
39 0.32
40 0.31
41 0.28
42 0.24
43 0.15
44 0.15
45 0.15
46 0.15
47 0.18
48 0.25
49 0.25
50 0.26
51 0.3
52 0.32
53 0.39
54 0.45
55 0.49
56 0.54
57 0.61
58 0.71
59 0.79
60 0.85
61 0.78
62 0.72
63 0.66
64 0.57
65 0.54