Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2UEM5

Protein Details
Accession A0A1Y2UEM5   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-82SWLQMRDRKKLEKKARQEKILNHydrophilic
134-158VTDTHAHEKPNKKKKPHRGYAFVVFHydrophilic
NLS Segment(s)
PositionSequence
70-74KLEKK
142-151KPNKKKKPHR
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR022023  U1snRNP70_N  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF12220  U1snRNP70_N  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MTDKLPPNLLALFAPRPPLRWVPAPDFPPEQRKTHPITAVAEYLPALFAYKDNDGYQPTESWLQMRDRKKLEKKARQEKILNEAPLHYKPAEDPNIRGDPFKTLIVARLSYDANEHDLEKEFGRFGPIERIRIVTDTHAHEKPNKKKKPHRGYAFVVFEREKDMRGNTAIDFSQIFYLGSIGSASSMSLTRDLALKLADLFLPFPFLFPVEIKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.26
4 0.3
5 0.34
6 0.34
7 0.39
8 0.44
9 0.44
10 0.51
11 0.5
12 0.5
13 0.51
14 0.5
15 0.51
16 0.49
17 0.46
18 0.44
19 0.48
20 0.51
21 0.51
22 0.51
23 0.45
24 0.45
25 0.44
26 0.41
27 0.35
28 0.28
29 0.22
30 0.18
31 0.14
32 0.1
33 0.08
34 0.06
35 0.06
36 0.09
37 0.11
38 0.13
39 0.14
40 0.16
41 0.17
42 0.18
43 0.19
44 0.16
45 0.17
46 0.17
47 0.16
48 0.16
49 0.17
50 0.22
51 0.28
52 0.33
53 0.38
54 0.41
55 0.51
56 0.59
57 0.66
58 0.71
59 0.73
60 0.79
61 0.83
62 0.84
63 0.82
64 0.79
65 0.71
66 0.68
67 0.64
68 0.55
69 0.44
70 0.38
71 0.34
72 0.3
73 0.29
74 0.21
75 0.15
76 0.15
77 0.21
78 0.26
79 0.23
80 0.23
81 0.26
82 0.3
83 0.31
84 0.3
85 0.24
86 0.2
87 0.21
88 0.19
89 0.15
90 0.11
91 0.14
92 0.15
93 0.14
94 0.12
95 0.12
96 0.12
97 0.11
98 0.12
99 0.09
100 0.1
101 0.1
102 0.1
103 0.09
104 0.1
105 0.11
106 0.11
107 0.11
108 0.09
109 0.09
110 0.1
111 0.09
112 0.09
113 0.18
114 0.2
115 0.21
116 0.21
117 0.23
118 0.22
119 0.23
120 0.23
121 0.15
122 0.17
123 0.2
124 0.24
125 0.24
126 0.25
127 0.3
128 0.4
129 0.48
130 0.54
131 0.58
132 0.63
133 0.72
134 0.82
135 0.86
136 0.87
137 0.86
138 0.82
139 0.81
140 0.8
141 0.76
142 0.66
143 0.59
144 0.48
145 0.4
146 0.37
147 0.31
148 0.23
149 0.19
150 0.19
151 0.18
152 0.2
153 0.21
154 0.17
155 0.19
156 0.18
157 0.17
158 0.16
159 0.14
160 0.13
161 0.11
162 0.11
163 0.08
164 0.08
165 0.07
166 0.07
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.06
173 0.07
174 0.08
175 0.09
176 0.09
177 0.09
178 0.12
179 0.12
180 0.13
181 0.12
182 0.12
183 0.11
184 0.12
185 0.12
186 0.11
187 0.11
188 0.1
189 0.15
190 0.14
191 0.14
192 0.14
193 0.14
194 0.15