Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZAD7

Protein Details
Accession H8ZAD7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
196-217FGKIVISKETPDKKRKKKQGDSBasic
NLS Segment(s)
PositionSequence
208-214KKRKKKQ
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, plas 2
Family & Domain DBs
Amino Acid Sequences MELLPIRARANEGTPNSSELFFIDSKKYSPEYFITCVFPFIPGVEKDETPNLKPKTGSPAIRVYEDLHKQIKKYTADIDRFKELADTPTINLSIDFKVLNYLHIQDKVCFRFPIKNEPEIYAADLFRAHSIPEGEVLAIFIFYIRESILVQIREILSPRDPEGIPVEKEEFQQKQATVHTEGISTLNQQHVRYDSFGKIVISKETPDKKRKKKQGDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.34
4 0.32
5 0.27
6 0.2
7 0.2
8 0.17
9 0.18
10 0.19
11 0.19
12 0.2
13 0.23
14 0.26
15 0.22
16 0.25
17 0.27
18 0.28
19 0.3
20 0.31
21 0.32
22 0.29
23 0.3
24 0.26
25 0.22
26 0.18
27 0.15
28 0.17
29 0.13
30 0.17
31 0.18
32 0.18
33 0.2
34 0.26
35 0.28
36 0.26
37 0.35
38 0.33
39 0.33
40 0.33
41 0.33
42 0.35
43 0.4
44 0.4
45 0.35
46 0.41
47 0.41
48 0.41
49 0.4
50 0.34
51 0.34
52 0.34
53 0.34
54 0.33
55 0.32
56 0.32
57 0.35
58 0.39
59 0.33
60 0.32
61 0.35
62 0.37
63 0.43
64 0.47
65 0.46
66 0.42
67 0.4
68 0.38
69 0.32
70 0.25
71 0.2
72 0.17
73 0.15
74 0.12
75 0.13
76 0.13
77 0.12
78 0.11
79 0.11
80 0.09
81 0.09
82 0.08
83 0.07
84 0.1
85 0.1
86 0.11
87 0.1
88 0.12
89 0.13
90 0.16
91 0.17
92 0.15
93 0.2
94 0.21
95 0.22
96 0.21
97 0.2
98 0.24
99 0.25
100 0.34
101 0.32
102 0.35
103 0.34
104 0.35
105 0.36
106 0.3
107 0.29
108 0.2
109 0.17
110 0.12
111 0.11
112 0.1
113 0.09
114 0.08
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.05
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.04
131 0.03
132 0.04
133 0.05
134 0.07
135 0.11
136 0.12
137 0.12
138 0.14
139 0.15
140 0.15
141 0.16
142 0.16
143 0.14
144 0.15
145 0.17
146 0.18
147 0.18
148 0.19
149 0.23
150 0.25
151 0.23
152 0.24
153 0.26
154 0.24
155 0.25
156 0.3
157 0.27
158 0.25
159 0.28
160 0.26
161 0.26
162 0.28
163 0.31
164 0.28
165 0.29
166 0.27
167 0.23
168 0.23
169 0.22
170 0.19
171 0.17
172 0.15
173 0.2
174 0.22
175 0.22
176 0.24
177 0.26
178 0.28
179 0.29
180 0.31
181 0.26
182 0.25
183 0.27
184 0.25
185 0.24
186 0.23
187 0.25
188 0.23
189 0.24
190 0.31
191 0.39
192 0.47
193 0.55
194 0.65
195 0.71
196 0.8
197 0.88