Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZA69

Protein Details
Accession H8ZA69    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-89KAAKQEIKKRKTQKIQEAEKEAHydrophilic
NLS Segment(s)
PositionSequence
64-78PRIEKAAKQEIKKRK
134-143LKTLRKARKS
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKRVRSKKIENDKKLSVLYEQEVDMSRVQEYTGPALATGVEKEEEEEHHLKEIISRRARDIPTPRIEKAAKQEIKKRKTQKIQEAEKEAVHEEPANYLEDTGDVNQPDIESIIMQEGDLPAEYLPFVCFRKRELKTLRKARKSDSSVEKIKKIKVDLQMIRRLTELTLQRDNYLSQHLSTIFNIFSICREMNKRLDIGVLNISESILRDILFTKITSKSDLFYKRIPSFTNLYLCRKSIGGLRKLLKAGPPPEHRLELTKKEIDYLNTYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.58
3 0.5
4 0.43
5 0.37
6 0.31
7 0.26
8 0.24
9 0.23
10 0.23
11 0.22
12 0.18
13 0.16
14 0.14
15 0.14
16 0.14
17 0.15
18 0.16
19 0.16
20 0.15
21 0.15
22 0.15
23 0.15
24 0.13
25 0.12
26 0.1
27 0.09
28 0.09
29 0.1
30 0.12
31 0.12
32 0.18
33 0.2
34 0.19
35 0.21
36 0.22
37 0.2
38 0.24
39 0.31
40 0.33
41 0.37
42 0.38
43 0.4
44 0.48
45 0.49
46 0.52
47 0.52
48 0.51
49 0.54
50 0.58
51 0.54
52 0.53
53 0.53
54 0.49
55 0.49
56 0.51
57 0.47
58 0.48
59 0.56
60 0.6
61 0.64
62 0.69
63 0.7
64 0.7
65 0.74
66 0.79
67 0.8
68 0.8
69 0.84
70 0.82
71 0.78
72 0.7
73 0.6
74 0.52
75 0.42
76 0.32
77 0.23
78 0.17
79 0.12
80 0.11
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.08
87 0.09
88 0.09
89 0.1
90 0.08
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.06
97 0.04
98 0.04
99 0.05
100 0.04
101 0.04
102 0.05
103 0.04
104 0.04
105 0.04
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.06
113 0.08
114 0.09
115 0.1
116 0.13
117 0.23
118 0.25
119 0.33
120 0.41
121 0.49
122 0.57
123 0.67
124 0.73
125 0.72
126 0.72
127 0.68
128 0.68
129 0.63
130 0.61
131 0.58
132 0.55
133 0.55
134 0.56
135 0.57
136 0.51
137 0.5
138 0.45
139 0.39
140 0.38
141 0.37
142 0.43
143 0.43
144 0.45
145 0.5
146 0.47
147 0.45
148 0.4
149 0.34
150 0.25
151 0.25
152 0.24
153 0.22
154 0.26
155 0.26
156 0.27
157 0.27
158 0.27
159 0.23
160 0.22
161 0.18
162 0.13
163 0.14
164 0.15
165 0.16
166 0.15
167 0.16
168 0.11
169 0.11
170 0.11
171 0.09
172 0.09
173 0.12
174 0.11
175 0.13
176 0.17
177 0.21
178 0.26
179 0.28
180 0.28
181 0.24
182 0.26
183 0.23
184 0.22
185 0.21
186 0.16
187 0.15
188 0.14
189 0.14
190 0.11
191 0.11
192 0.11
193 0.07
194 0.07
195 0.07
196 0.08
197 0.1
198 0.11
199 0.11
200 0.13
201 0.16
202 0.17
203 0.21
204 0.2
205 0.21
206 0.28
207 0.34
208 0.34
209 0.35
210 0.43
211 0.43
212 0.46
213 0.46
214 0.42
215 0.41
216 0.42
217 0.46
218 0.43
219 0.45
220 0.45
221 0.43
222 0.41
223 0.36
224 0.32
225 0.31
226 0.35
227 0.35
228 0.4
229 0.43
230 0.46
231 0.48
232 0.48
233 0.47
234 0.46
235 0.46
236 0.48
237 0.51
238 0.53
239 0.56
240 0.58
241 0.54
242 0.54
243 0.55
244 0.53
245 0.54
246 0.52
247 0.47
248 0.47
249 0.49
250 0.45