Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VH47

Protein Details
Accession A0A1Y2VH47    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
100-122EKSRTLEKTKKRASHFPQRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-119RPKQTRAIRRRLSPEEKSRTLEKTKKRASHFPQRK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTAKVKTGQLWGKSKEDLLKTLGELKTELGQLRIQKVVSSGSKLNKIHDLRKSIARVLTVVNLKQRSQLRLFYKNKKYLPLDLRPKQTRAIRRRLSPEEKSRTLEKTKKRASHFPQRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.47
4 0.42
5 0.37
6 0.32
7 0.29
8 0.26
9 0.32
10 0.3
11 0.24
12 0.22
13 0.2
14 0.2
15 0.21
16 0.2
17 0.15
18 0.17
19 0.19
20 0.21
21 0.21
22 0.19
23 0.17
24 0.17
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.38
39 0.43
40 0.43
41 0.37
42 0.35
43 0.29
44 0.24
45 0.2
46 0.21
47 0.17
48 0.17
49 0.19
50 0.19
51 0.19
52 0.24
53 0.25
54 0.25
55 0.26
56 0.32
57 0.33
58 0.42
59 0.49
60 0.53
61 0.6
62 0.64
63 0.63
64 0.63
65 0.6
66 0.58
67 0.58
68 0.58
69 0.6
70 0.58
71 0.66
72 0.63
73 0.62
74 0.61
75 0.61
76 0.61
77 0.59
78 0.64
79 0.61
80 0.64
81 0.71
82 0.73
83 0.74
84 0.73
85 0.75
86 0.73
87 0.7
88 0.67
89 0.63
90 0.6
91 0.61
92 0.61
93 0.6
94 0.62
95 0.68
96 0.72
97 0.75
98 0.79
99 0.78
100 0.81
101 0.82
102 0.8
103 0.8
104 0.8
105 0.8