Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2UNQ1

Protein Details
Accession A0A1Y2UNQ1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-130SEEEREREKKERERREREEREREERERERREREEREREEAcidic
NLS Segment(s)
PositionSequence
97-132EREKKERERREREEREREERERERREREEREREERE
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTDDLEYFKGKHEERLEEIEETLLELSSMKRSINRKRDDGDDSYDEELERIEKLITSIEEEKEDILLELKDIEEEIEKLEAAESEDESEEDSEEEREREKKERERREREEREREERERERREREEREREERERAEKDEEMEDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.45
4 0.39
5 0.38
6 0.31
7 0.25
8 0.21
9 0.16
10 0.1
11 0.07
12 0.06
13 0.07
14 0.09
15 0.1
16 0.1
17 0.16
18 0.24
19 0.35
20 0.44
21 0.5
22 0.52
23 0.54
24 0.59
25 0.59
26 0.55
27 0.5
28 0.43
29 0.39
30 0.35
31 0.32
32 0.26
33 0.21
34 0.17
35 0.11
36 0.09
37 0.07
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.1
44 0.12
45 0.12
46 0.13
47 0.13
48 0.13
49 0.11
50 0.11
51 0.08
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.08
82 0.1
83 0.13
84 0.16
85 0.23
86 0.31
87 0.39
88 0.49
89 0.6
90 0.68
91 0.75
92 0.81
93 0.85
94 0.88
95 0.88
96 0.89
97 0.85
98 0.83
99 0.81
100 0.76
101 0.75
102 0.73
103 0.73
104 0.72
105 0.72
106 0.72
107 0.73
108 0.78
109 0.78
110 0.79
111 0.8
112 0.77
113 0.79
114 0.78
115 0.73
116 0.73
117 0.69
118 0.66
119 0.61
120 0.57
121 0.54
122 0.49
123 0.48