Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2U8D4

Protein Details
Accession A0A1Y2U8D4   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-70GYCKSKKPKLNKVISKNNKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027434  Homing_endonucl  
IPR004860  LAGLIDADG_2  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF03161  LAGLIDADG_2  
Amino Acid Sequences NNKDCISLIIGSLLGNSYMEKNEKGVRIVFIKCSGNIEYLIQFFNYLSNIGYCKSKKPKLNKVISKNNKVLYYFKTETMPCLNYYHELFYKDGIKIIPKNISELLTARSLALLLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.1
6 0.13
7 0.13
8 0.15
9 0.2
10 0.22
11 0.23
12 0.23
13 0.24
14 0.26
15 0.27
16 0.26
17 0.26
18 0.25
19 0.24
20 0.25
21 0.23
22 0.2
23 0.19
24 0.18
25 0.15
26 0.14
27 0.14
28 0.11
29 0.1
30 0.09
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.07
37 0.08
38 0.12
39 0.12
40 0.19
41 0.27
42 0.33
43 0.39
44 0.48
45 0.58
46 0.63
47 0.73
48 0.74
49 0.75
50 0.8
51 0.82
52 0.8
53 0.74
54 0.67
55 0.59
56 0.52
57 0.46
58 0.38
59 0.39
60 0.33
61 0.3
62 0.3
63 0.28
64 0.29
65 0.3
66 0.29
67 0.21
68 0.21
69 0.21
70 0.2
71 0.21
72 0.23
73 0.2
74 0.21
75 0.2
76 0.21
77 0.23
78 0.21
79 0.22
80 0.19
81 0.22
82 0.23
83 0.27
84 0.31
85 0.28
86 0.31
87 0.31
88 0.32
89 0.28
90 0.27
91 0.25
92 0.21
93 0.21
94 0.17
95 0.15
96 0.14