Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2U9P2

Protein Details
Accession A0A1Y2U9P2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-79GLATKPERASRQQRKQRKNRQKTLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
53-87KPERASRQQRKQRKNRQKTLRGTAKVKGAKAKKEK
Subcellular Location(s) mito 13, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MYKAQKDQISVFGLRTQFGGGKTTGFALVYDSPEAMKKFEPQYRLVRVGLATKPERASRQQRKQRKNRQKTLRGTAKVKGAKAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.19
4 0.17
5 0.16
6 0.17
7 0.13
8 0.13
9 0.13
10 0.14
11 0.13
12 0.1
13 0.09
14 0.1
15 0.11
16 0.11
17 0.11
18 0.11
19 0.1
20 0.13
21 0.13
22 0.12
23 0.11
24 0.14
25 0.19
26 0.22
27 0.25
28 0.27
29 0.32
30 0.35
31 0.37
32 0.33
33 0.29
34 0.26
35 0.27
36 0.24
37 0.23
38 0.2
39 0.2
40 0.22
41 0.24
42 0.26
43 0.3
44 0.4
45 0.45
46 0.55
47 0.63
48 0.72
49 0.8
50 0.88
51 0.92
52 0.93
53 0.93
54 0.93
55 0.93
56 0.93
57 0.92
58 0.91
59 0.9
60 0.86
61 0.79
62 0.74
63 0.72
64 0.67
65 0.62
66 0.61
67 0.58