Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZAK7

Protein Details
Accession H8ZAK7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-169ETDKMSLKPKKKTMNEATDPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007758  Nucleoporin_NSP1_C  
Pfam View protein in Pfam  
PF05064  Nsp1_C  
Amino Acid Sequences MQLTEEPYHYLQKKVESILEELISELNENVSEFKEISKKVYEVEEVILHSRGKYIKVSKEVEEELKRQNEIEKVLEYFEAEIDKLKQKLQATANYNSAEQRPNYSSIGDISSLITEFNELVSMLDLGIPNKINILLNKNINIINQIEEETDKMSLKPKKKTMNEATDPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.32
4 0.33
5 0.32
6 0.3
7 0.24
8 0.21
9 0.18
10 0.15
11 0.12
12 0.1
13 0.07
14 0.06
15 0.07
16 0.07
17 0.08
18 0.09
19 0.09
20 0.11
21 0.17
22 0.17
23 0.2
24 0.23
25 0.22
26 0.22
27 0.25
28 0.24
29 0.19
30 0.21
31 0.18
32 0.16
33 0.17
34 0.18
35 0.15
36 0.14
37 0.15
38 0.14
39 0.15
40 0.19
41 0.23
42 0.27
43 0.34
44 0.37
45 0.36
46 0.39
47 0.39
48 0.4
49 0.37
50 0.34
51 0.33
52 0.32
53 0.3
54 0.27
55 0.28
56 0.23
57 0.22
58 0.21
59 0.17
60 0.15
61 0.16
62 0.15
63 0.12
64 0.1
65 0.08
66 0.07
67 0.06
68 0.06
69 0.07
70 0.1
71 0.11
72 0.11
73 0.15
74 0.15
75 0.21
76 0.24
77 0.29
78 0.31
79 0.33
80 0.36
81 0.33
82 0.33
83 0.28
84 0.26
85 0.22
86 0.17
87 0.18
88 0.17
89 0.19
90 0.19
91 0.18
92 0.17
93 0.15
94 0.16
95 0.13
96 0.11
97 0.09
98 0.08
99 0.08
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.08
115 0.09
116 0.08
117 0.08
118 0.1
119 0.11
120 0.13
121 0.18
122 0.22
123 0.25
124 0.26
125 0.28
126 0.28
127 0.26
128 0.26
129 0.22
130 0.18
131 0.16
132 0.15
133 0.14
134 0.14
135 0.15
136 0.14
137 0.14
138 0.13
139 0.13
140 0.21
141 0.28
142 0.35
143 0.43
144 0.51
145 0.6
146 0.66
147 0.76
148 0.78
149 0.81
150 0.81