Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZFN8

Protein Details
Accession H8ZFN8   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43IKGKNKPFYKEYKKEKEKNKNKRTGLCEBasic
73-94IDIIIERYKKREKRMSKKRLFIHydrophilic
NLS Segment(s)
PositionSequence
21-38KPFYKEYKKEKEKNKNKR
81-91KKREKRMSKKR
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
Amino Acid Sequences MEYFVFNSPYILIEDIKGKNKPFYKEYKKEKEKNKNKRTGLCELCVAGYENYNEHISAEKHKKIEEKINYEEIDIIIERYKKREKRMSKKRLFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.26
4 0.29
5 0.29
6 0.35
7 0.4
8 0.44
9 0.43
10 0.5
11 0.55
12 0.62
13 0.7
14 0.74
15 0.79
16 0.82
17 0.87
18 0.88
19 0.88
20 0.89
21 0.89
22 0.88
23 0.84
24 0.83
25 0.78
26 0.76
27 0.69
28 0.59
29 0.5
30 0.4
31 0.34
32 0.26
33 0.22
34 0.13
35 0.1
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.08
42 0.1
43 0.1
44 0.18
45 0.24
46 0.26
47 0.27
48 0.29
49 0.34
50 0.36
51 0.45
52 0.45
53 0.45
54 0.46
55 0.5
56 0.48
57 0.44
58 0.4
59 0.31
60 0.24
61 0.18
62 0.14
63 0.13
64 0.16
65 0.17
66 0.23
67 0.33
68 0.37
69 0.47
70 0.56
71 0.64
72 0.71
73 0.82
74 0.87