Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2USR4

Protein Details
Accession A0A1Y2USR4    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-29SGGSRARTRKVRYVHRKCRGLQFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6, plas 4, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYLRVSGGSRARTRKVRYVHRKCRGLQFHNQSQKLVPRNHCFMIYVFLVLAWLSCRNRRDGWRVSCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.82
7 0.83
8 0.84
9 0.79
10 0.8
11 0.78
12 0.72
13 0.7
14 0.68
15 0.67
16 0.69
17 0.67
18 0.57
19 0.49
20 0.5
21 0.47
22 0.45
23 0.42
24 0.38
25 0.41
26 0.42
27 0.4
28 0.36
29 0.29
30 0.27
31 0.2
32 0.16
33 0.11
34 0.1
35 0.1
36 0.08
37 0.08
38 0.06
39 0.11
40 0.13
41 0.19
42 0.21
43 0.26
44 0.32
45 0.39
46 0.46
47 0.51