Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2V1I9

Protein Details
Accession A0A1Y2V1I9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-27SIGPQLPPKITKRKRTPNDESPDSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MSSIGPQLPPKITKRKRTPNDESPDSPAAKLQATDRNKDEVDLSSDDEDDYGPSVPKSTAKAPIGPIGPSLPPSNTDEINLDDSDDDDIGPSAPPPPTTTQPSVGPTLPPKNQDEIPLEDDDGSEDDVGPAPQPGPTPAPAPAPAPTPITAKRVQGPAPPPASLSERPPTSPNSNSDSESEDDDDDYGPALPTSSSHLARQTQARAASEAARAAEEAAGPRRDDWMLAPPTSSSGYRAPDPTKLKNRRFQSGPRTSTSTSTSASGNTSGNGEISSIWTETPEQKRKRLENAVLGRESASSTTTTTTTTTQKTSAGGSGGNLRGPGPGLEKKEEDAEQQARIRSFTEATRGKSLYEEHQQSRKGRTLAPDEEEDDPSKRAFDREKDMKLSGRIGTAQRRELLNRAADFGGRFAKGKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.84
4 0.88
5 0.9
6 0.89
7 0.9
8 0.87
9 0.79
10 0.75
11 0.71
12 0.62
13 0.53
14 0.44
15 0.37
16 0.3
17 0.28
18 0.26
19 0.29
20 0.33
21 0.39
22 0.4
23 0.43
24 0.42
25 0.41
26 0.38
27 0.31
28 0.32
29 0.28
30 0.27
31 0.22
32 0.22
33 0.21
34 0.19
35 0.16
36 0.12
37 0.11
38 0.1
39 0.1
40 0.1
41 0.11
42 0.12
43 0.15
44 0.19
45 0.22
46 0.29
47 0.3
48 0.35
49 0.35
50 0.4
51 0.39
52 0.35
53 0.32
54 0.26
55 0.24
56 0.22
57 0.22
58 0.16
59 0.17
60 0.21
61 0.23
62 0.21
63 0.21
64 0.21
65 0.21
66 0.24
67 0.21
68 0.17
69 0.14
70 0.14
71 0.14
72 0.12
73 0.09
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.09
80 0.09
81 0.1
82 0.13
83 0.17
84 0.22
85 0.28
86 0.31
87 0.32
88 0.34
89 0.36
90 0.36
91 0.33
92 0.31
93 0.3
94 0.34
95 0.35
96 0.35
97 0.36
98 0.36
99 0.37
100 0.39
101 0.37
102 0.34
103 0.34
104 0.31
105 0.28
106 0.25
107 0.23
108 0.19
109 0.15
110 0.11
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.07
120 0.08
121 0.09
122 0.11
123 0.12
124 0.14
125 0.15
126 0.17
127 0.17
128 0.18
129 0.17
130 0.17
131 0.17
132 0.18
133 0.17
134 0.19
135 0.2
136 0.24
137 0.25
138 0.25
139 0.27
140 0.29
141 0.29
142 0.31
143 0.32
144 0.34
145 0.34
146 0.32
147 0.28
148 0.27
149 0.3
150 0.26
151 0.27
152 0.25
153 0.24
154 0.25
155 0.27
156 0.29
157 0.29
158 0.31
159 0.31
160 0.31
161 0.32
162 0.31
163 0.31
164 0.29
165 0.25
166 0.23
167 0.2
168 0.15
169 0.13
170 0.12
171 0.11
172 0.08
173 0.07
174 0.06
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.09
181 0.12
182 0.13
183 0.14
184 0.17
185 0.18
186 0.21
187 0.24
188 0.22
189 0.21
190 0.22
191 0.22
192 0.2
193 0.19
194 0.19
195 0.16
196 0.14
197 0.11
198 0.09
199 0.09
200 0.08
201 0.07
202 0.06
203 0.06
204 0.09
205 0.1
206 0.1
207 0.1
208 0.12
209 0.11
210 0.12
211 0.11
212 0.16
213 0.18
214 0.18
215 0.18
216 0.16
217 0.17
218 0.18
219 0.17
220 0.12
221 0.13
222 0.15
223 0.16
224 0.2
225 0.2
226 0.26
227 0.31
228 0.37
229 0.44
230 0.52
231 0.58
232 0.62
233 0.64
234 0.64
235 0.64
236 0.64
237 0.64
238 0.64
239 0.61
240 0.57
241 0.58
242 0.52
243 0.5
244 0.45
245 0.36
246 0.27
247 0.24
248 0.22
249 0.17
250 0.17
251 0.16
252 0.13
253 0.11
254 0.11
255 0.1
256 0.09
257 0.09
258 0.08
259 0.06
260 0.07
261 0.08
262 0.07
263 0.07
264 0.08
265 0.09
266 0.16
267 0.26
268 0.34
269 0.37
270 0.43
271 0.52
272 0.56
273 0.63
274 0.65
275 0.61
276 0.61
277 0.65
278 0.64
279 0.56
280 0.52
281 0.43
282 0.35
283 0.3
284 0.21
285 0.14
286 0.09
287 0.09
288 0.1
289 0.1
290 0.11
291 0.12
292 0.15
293 0.18
294 0.2
295 0.21
296 0.21
297 0.22
298 0.22
299 0.22
300 0.2
301 0.16
302 0.14
303 0.13
304 0.18
305 0.17
306 0.17
307 0.16
308 0.14
309 0.14
310 0.14
311 0.15
312 0.14
313 0.19
314 0.22
315 0.26
316 0.27
317 0.28
318 0.31
319 0.31
320 0.27
321 0.3
322 0.28
323 0.3
324 0.32
325 0.35
326 0.31
327 0.31
328 0.3
329 0.25
330 0.24
331 0.21
332 0.27
333 0.29
334 0.32
335 0.37
336 0.37
337 0.35
338 0.35
339 0.36
340 0.33
341 0.38
342 0.41
343 0.41
344 0.47
345 0.53
346 0.55
347 0.59
348 0.59
349 0.53
350 0.49
351 0.51
352 0.52
353 0.52
354 0.52
355 0.49
356 0.44
357 0.44
358 0.44
359 0.39
360 0.33
361 0.28
362 0.24
363 0.23
364 0.21
365 0.24
366 0.28
367 0.32
368 0.41
369 0.48
370 0.54
371 0.57
372 0.6
373 0.6
374 0.56
375 0.54
376 0.45
377 0.39
378 0.38
379 0.39
380 0.45
381 0.45
382 0.46
383 0.46
384 0.48
385 0.48
386 0.49
387 0.49
388 0.47
389 0.42
390 0.41
391 0.38
392 0.36
393 0.33
394 0.31
395 0.29
396 0.23
397 0.23