Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2VHW4

Protein Details
Accession A0A1Y2VHW4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-88EDMRDSKTQRLSRRKRRIASVLAHydrophilic
NLS Segment(s)
PositionSequence
78-81RRKR
Subcellular Location(s) mito 9, extr 7, mito_nucl 7, nucl 5
Family & Domain DBs
Amino Acid Sequences MRGRIPSTGLVGLAAFSLALGVDQQNLATICWFVVSVSVRSVSPGSNSCKCCCITDGLVLKLWTLEDMRDSKTQRLSRRKRRIASVLAHLLFDSRKKEKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.04
21 0.07
22 0.09
23 0.09
24 0.1
25 0.11
26 0.11
27 0.12
28 0.12
29 0.1
30 0.1
31 0.14
32 0.18
33 0.24
34 0.26
35 0.26
36 0.28
37 0.28
38 0.27
39 0.24
40 0.22
41 0.17
42 0.22
43 0.24
44 0.22
45 0.24
46 0.22
47 0.21
48 0.18
49 0.17
50 0.11
51 0.08
52 0.07
53 0.08
54 0.1
55 0.14
56 0.19
57 0.22
58 0.25
59 0.33
60 0.39
61 0.45
62 0.55
63 0.62
64 0.69
65 0.78
66 0.84
67 0.81
68 0.84
69 0.83
70 0.8
71 0.74
72 0.72
73 0.69
74 0.6
75 0.54
76 0.45
77 0.38
78 0.32
79 0.31
80 0.29
81 0.24