Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZDJ0

Protein Details
Accession H8ZDJ0   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-107STSSTQKPPKACKTKNCNGTIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 13, nucl 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015256  eIF2g_C  
IPR044127  eIF2g_dom_2  
IPR044128  eIF2g_GTP-bd  
IPR027417  P-loop_NTPase  
IPR000795  T_Tr_GTP-bd_dom  
IPR009000  Transl_B-barrel_sf  
IPR009001  Transl_elong_EF1A/Init_IF2_C  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0003743  F:translation initiation factor activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF09173  eIF2_C  
PF00009  GTP_EFTU  
PROSITE View protein in PROSITE  
PS51722  G_TR_2  
CDD cd01888  eIF2_gamma  
cd03688  eIF2_gamma_II  
Amino Acid Sequences MQTTVVEGIELGPVSQDIMKNQATVNIGMIGHVAHGKSTIVKAISGIKTVRFKSELERNITIKLGYANAKIYKCTGGICKRPECYMSTSSTQKPPKACKTKNCNGTIQLERHVSFVDCPGHEVLMDTMLTGAAIMDAAILIIAANEQCPQPQTIEHLNAIDVVDLDKVIILQNKVDLLSREQALENHDQIEEFIKDSSACNAPIIPTSAQIGCNLDAILDYIVNYIPVPQREYALPPQVQVIRSFDINKPGCKPSDYKGGVIGGCLTSGYLQAGEELEVRPGILEKVKGKLVCKPVRTKIVSLFAESNTLKVAVPGGLVGIGTELDPFFCRGDKLVGQVLGRPGTLPEVYREMGISYHLFEKLTAQIPALGKPLAVKEQLLINIGSSSSRIQITAATKNTAFFILATPICAKIGATLSISRKMSGHWRLIGAGEIEKGTSIPIIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.12
5 0.18
6 0.19
7 0.2
8 0.2
9 0.23
10 0.23
11 0.22
12 0.22
13 0.19
14 0.18
15 0.17
16 0.17
17 0.12
18 0.11
19 0.12
20 0.11
21 0.08
22 0.09
23 0.1
24 0.12
25 0.13
26 0.16
27 0.15
28 0.15
29 0.17
30 0.24
31 0.25
32 0.27
33 0.27
34 0.29
35 0.35
36 0.37
37 0.4
38 0.34
39 0.33
40 0.38
41 0.46
42 0.47
43 0.48
44 0.52
45 0.48
46 0.48
47 0.48
48 0.4
49 0.31
50 0.26
51 0.22
52 0.2
53 0.2
54 0.23
55 0.28
56 0.29
57 0.29
58 0.29
59 0.27
60 0.25
61 0.26
62 0.3
63 0.32
64 0.4
65 0.46
66 0.5
67 0.5
68 0.52
69 0.51
70 0.46
71 0.43
72 0.39
73 0.36
74 0.35
75 0.39
76 0.41
77 0.48
78 0.5
79 0.49
80 0.52
81 0.57
82 0.63
83 0.68
84 0.71
85 0.72
86 0.77
87 0.81
88 0.83
89 0.79
90 0.73
91 0.66
92 0.65
93 0.61
94 0.54
95 0.5
96 0.45
97 0.4
98 0.36
99 0.33
100 0.26
101 0.2
102 0.22
103 0.21
104 0.17
105 0.19
106 0.19
107 0.18
108 0.17
109 0.17
110 0.12
111 0.09
112 0.09
113 0.07
114 0.06
115 0.06
116 0.06
117 0.05
118 0.04
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.03
132 0.04
133 0.05
134 0.05
135 0.07
136 0.08
137 0.08
138 0.09
139 0.14
140 0.18
141 0.21
142 0.21
143 0.2
144 0.19
145 0.19
146 0.18
147 0.13
148 0.09
149 0.06
150 0.06
151 0.05
152 0.05
153 0.04
154 0.04
155 0.05
156 0.08
157 0.08
158 0.08
159 0.09
160 0.09
161 0.1
162 0.11
163 0.11
164 0.11
165 0.13
166 0.14
167 0.14
168 0.14
169 0.15
170 0.18
171 0.2
172 0.17
173 0.16
174 0.15
175 0.14
176 0.14
177 0.15
178 0.12
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.11
185 0.1
186 0.1
187 0.09
188 0.09
189 0.1
190 0.1
191 0.12
192 0.1
193 0.09
194 0.1
195 0.11
196 0.11
197 0.11
198 0.12
199 0.1
200 0.1
201 0.09
202 0.07
203 0.06
204 0.06
205 0.06
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.06
213 0.08
214 0.09
215 0.11
216 0.1
217 0.12
218 0.12
219 0.16
220 0.18
221 0.22
222 0.21
223 0.2
224 0.22
225 0.24
226 0.24
227 0.21
228 0.2
229 0.15
230 0.16
231 0.19
232 0.17
233 0.24
234 0.25
235 0.26
236 0.27
237 0.28
238 0.28
239 0.28
240 0.29
241 0.23
242 0.32
243 0.32
244 0.29
245 0.28
246 0.29
247 0.27
248 0.24
249 0.22
250 0.11
251 0.09
252 0.08
253 0.06
254 0.04
255 0.05
256 0.05
257 0.04
258 0.04
259 0.04
260 0.05
261 0.05
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.06
269 0.07
270 0.07
271 0.1
272 0.12
273 0.15
274 0.18
275 0.2
276 0.21
277 0.27
278 0.35
279 0.38
280 0.43
281 0.47
282 0.51
283 0.58
284 0.6
285 0.55
286 0.51
287 0.53
288 0.48
289 0.43
290 0.39
291 0.3
292 0.33
293 0.3
294 0.25
295 0.16
296 0.17
297 0.13
298 0.12
299 0.12
300 0.07
301 0.07
302 0.06
303 0.06
304 0.05
305 0.05
306 0.04
307 0.04
308 0.03
309 0.03
310 0.04
311 0.04
312 0.04
313 0.06
314 0.07
315 0.07
316 0.08
317 0.09
318 0.1
319 0.14
320 0.15
321 0.17
322 0.2
323 0.22
324 0.22
325 0.24
326 0.26
327 0.22
328 0.21
329 0.18
330 0.15
331 0.15
332 0.16
333 0.14
334 0.13
335 0.16
336 0.17
337 0.17
338 0.17
339 0.14
340 0.14
341 0.15
342 0.13
343 0.11
344 0.13
345 0.13
346 0.13
347 0.13
348 0.15
349 0.17
350 0.19
351 0.18
352 0.16
353 0.2
354 0.21
355 0.23
356 0.23
357 0.18
358 0.15
359 0.17
360 0.19
361 0.18
362 0.18
363 0.17
364 0.16
365 0.2
366 0.21
367 0.21
368 0.18
369 0.15
370 0.14
371 0.14
372 0.13
373 0.11
374 0.1
375 0.11
376 0.11
377 0.11
378 0.11
379 0.16
380 0.21
381 0.27
382 0.29
383 0.3
384 0.3
385 0.3
386 0.31
387 0.26
388 0.22
389 0.15
390 0.14
391 0.17
392 0.16
393 0.18
394 0.18
395 0.18
396 0.18
397 0.17
398 0.15
399 0.13
400 0.15
401 0.15
402 0.16
403 0.21
404 0.25
405 0.32
406 0.33
407 0.3
408 0.28
409 0.29
410 0.37
411 0.39
412 0.42
413 0.39
414 0.39
415 0.39
416 0.4
417 0.4
418 0.32
419 0.26
420 0.2
421 0.17
422 0.15
423 0.14
424 0.13
425 0.11
426 0.1