Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2VKH6

Protein Details
Accession A0A1Y2VKH6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-37SEPVPPSSKGKPRKRLEPHYELTHydrophilic
NLS Segment(s)
PositionSequence
25-27KPR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024158  Mt_import_TIM15  
IPR007853  Znf_DNL-typ  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05180  zf-DNL  
PROSITE View protein in PROSITE  
PS51501  ZF_DNL  
Amino Acid Sequences RLAHSIPRPPSQTSSEPVPPSSKGKPRKRLEPHYELTFTCVPCSGRSTHTVSKQGYHKGSVLITCPSCRNRHIISDHLNIFGDRSITVEDLMREKGQLVKRGTLGETGDIEFWEDGTVTER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.44
4 0.43
5 0.41
6 0.38
7 0.39
8 0.43
9 0.45
10 0.49
11 0.57
12 0.65
13 0.69
14 0.77
15 0.81
16 0.84
17 0.84
18 0.82
19 0.77
20 0.73
21 0.68
22 0.57
23 0.52
24 0.45
25 0.36
26 0.28
27 0.24
28 0.19
29 0.18
30 0.2
31 0.17
32 0.16
33 0.19
34 0.25
35 0.28
36 0.33
37 0.38
38 0.36
39 0.39
40 0.41
41 0.43
42 0.38
43 0.34
44 0.3
45 0.25
46 0.24
47 0.2
48 0.17
49 0.14
50 0.13
51 0.13
52 0.16
53 0.18
54 0.19
55 0.2
56 0.24
57 0.23
58 0.29
59 0.31
60 0.33
61 0.36
62 0.4
63 0.4
64 0.35
65 0.34
66 0.27
67 0.25
68 0.19
69 0.14
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.1
77 0.12
78 0.14
79 0.13
80 0.12
81 0.13
82 0.19
83 0.23
84 0.29
85 0.3
86 0.32
87 0.34
88 0.36
89 0.36
90 0.32
91 0.29
92 0.23
93 0.22
94 0.19
95 0.18
96 0.16
97 0.17
98 0.13
99 0.12
100 0.1
101 0.08