Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZCR8

Protein Details
Accession H8ZCR8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-108AVPSLPIQCRRIRKKREEKRKRDVRSBasic
NLS Segment(s)
PositionSequence
92-108RRIRKKREEKRKRDVRS
Subcellular Location(s) plas 9, mito 8, extr 7, cyto 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences VCTALFSAFPSSWPVCASTSSIPISASSSCAIPRSAKCCTMPAGRPKPLFLSLPLATSVLFSLLLSAACISIFAKIFRSASIAVPSLPIQCRRIRKKREEKRKRDVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.18
4 0.21
5 0.17
6 0.2
7 0.21
8 0.2
9 0.19
10 0.18
11 0.19
12 0.15
13 0.15
14 0.12
15 0.11
16 0.11
17 0.12
18 0.13
19 0.15
20 0.18
21 0.21
22 0.24
23 0.26
24 0.27
25 0.27
26 0.3
27 0.31
28 0.34
29 0.4
30 0.45
31 0.47
32 0.47
33 0.46
34 0.44
35 0.41
36 0.36
37 0.27
38 0.25
39 0.19
40 0.19
41 0.19
42 0.16
43 0.13
44 0.13
45 0.11
46 0.06
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.09
62 0.11
63 0.12
64 0.12
65 0.14
66 0.14
67 0.15
68 0.18
69 0.16
70 0.15
71 0.16
72 0.17
73 0.18
74 0.21
75 0.23
76 0.23
77 0.3
78 0.4
79 0.49
80 0.59
81 0.65
82 0.73
83 0.81
84 0.88
85 0.93
86 0.94
87 0.93
88 0.94