Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SSV9

Protein Details
Accession A0A1Z5SSV9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
267-287SSGQNDRKRKRAKTIKDDEDEBasic
NLS Segment(s)
PositionSequence
274-277KRKR
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR008921  DNA_pol3_clamp-load_cplx_C  
IPR027417  P-loop_NTPase  
IPR013748  Rep_factorC_C  
Gene Ontology GO:0031391  C:Elg1 RFC-like complex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0090618  P:DNA clamp unloading  
GO:0006271  P:DNA strand elongation involved in DNA replication  
Pfam View protein in Pfam  
PF00004  AAA  
PF08542  Rep_fac_C  
CDD cd00009  AAA  
cd18140  HLD_clamp_RFC  
Amino Acid Sequences MADFFNIRARQQAAAQASASSSKKDAQKEVVTRLQPWVEKYRPKSLDDVTAQDHTVTVLRRTLQSANLPHMLFYGPPGTGKTSTVLALAKQLYGPDLIKSRVLELNASDERGISIVREKVKDFARMQLSNPPAGPAGEEYRRKYPCPPYKIVVLDEADSMTQDAQSALRRTMETYSKITRFCLVCNYVTRIIDPLASRCSKFRFKSLDEANAGKRLEDIAKLEGVKLEDGVVDTLLKCSEGDLRKAITFLQSAPRLVGATQPADPSSSGQNDRKRKRAKTIKDDEDEESGEAMEVDSAAPTSPPVSVSSIEEIAGVIPEPTIDGLVEAMQPSKQGTAYSRVSKCVEDLVAEGWSASTVVTQLYEKIVIGEEVMQDWQKARIVGIFSEVDKRLVDGSDEHLTILDLNLRVASILGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.25
5 0.29
6 0.28
7 0.23
8 0.21
9 0.25
10 0.31
11 0.36
12 0.4
13 0.42
14 0.5
15 0.54
16 0.6
17 0.62
18 0.58
19 0.54
20 0.54
21 0.52
22 0.45
23 0.44
24 0.46
25 0.46
26 0.52
27 0.56
28 0.61
29 0.6
30 0.6
31 0.6
32 0.54
33 0.56
34 0.5
35 0.49
36 0.42
37 0.4
38 0.38
39 0.32
40 0.28
41 0.2
42 0.2
43 0.17
44 0.16
45 0.17
46 0.19
47 0.2
48 0.24
49 0.25
50 0.27
51 0.32
52 0.34
53 0.36
54 0.39
55 0.37
56 0.34
57 0.32
58 0.28
59 0.2
60 0.19
61 0.16
62 0.1
63 0.11
64 0.13
65 0.16
66 0.16
67 0.17
68 0.17
69 0.16
70 0.16
71 0.17
72 0.17
73 0.13
74 0.17
75 0.17
76 0.16
77 0.15
78 0.14
79 0.13
80 0.14
81 0.14
82 0.12
83 0.15
84 0.16
85 0.18
86 0.18
87 0.21
88 0.21
89 0.21
90 0.19
91 0.17
92 0.23
93 0.22
94 0.22
95 0.19
96 0.16
97 0.16
98 0.15
99 0.14
100 0.07
101 0.11
102 0.15
103 0.19
104 0.21
105 0.21
106 0.26
107 0.3
108 0.36
109 0.33
110 0.36
111 0.39
112 0.38
113 0.39
114 0.41
115 0.4
116 0.35
117 0.34
118 0.27
119 0.2
120 0.19
121 0.18
122 0.13
123 0.16
124 0.2
125 0.25
126 0.27
127 0.35
128 0.37
129 0.38
130 0.42
131 0.48
132 0.51
133 0.54
134 0.56
135 0.5
136 0.54
137 0.55
138 0.49
139 0.43
140 0.34
141 0.27
142 0.23
143 0.2
144 0.14
145 0.11
146 0.1
147 0.06
148 0.05
149 0.05
150 0.05
151 0.06
152 0.1
153 0.11
154 0.12
155 0.13
156 0.14
157 0.15
158 0.18
159 0.21
160 0.2
161 0.23
162 0.28
163 0.29
164 0.3
165 0.29
166 0.31
167 0.27
168 0.25
169 0.26
170 0.23
171 0.23
172 0.25
173 0.28
174 0.26
175 0.25
176 0.25
177 0.2
178 0.18
179 0.18
180 0.16
181 0.13
182 0.15
183 0.16
184 0.16
185 0.17
186 0.22
187 0.27
188 0.28
189 0.33
190 0.34
191 0.35
192 0.43
193 0.45
194 0.46
195 0.4
196 0.42
197 0.36
198 0.34
199 0.32
200 0.23
201 0.2
202 0.15
203 0.14
204 0.12
205 0.13
206 0.09
207 0.11
208 0.11
209 0.11
210 0.11
211 0.11
212 0.1
213 0.08
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.12
227 0.13
228 0.15
229 0.17
230 0.18
231 0.18
232 0.19
233 0.19
234 0.14
235 0.13
236 0.12
237 0.17
238 0.17
239 0.17
240 0.17
241 0.17
242 0.15
243 0.15
244 0.16
245 0.11
246 0.11
247 0.12
248 0.13
249 0.13
250 0.13
251 0.13
252 0.12
253 0.13
254 0.16
255 0.2
256 0.26
257 0.34
258 0.44
259 0.49
260 0.58
261 0.63
262 0.64
263 0.7
264 0.75
265 0.76
266 0.77
267 0.82
268 0.81
269 0.77
270 0.75
271 0.66
272 0.58
273 0.48
274 0.38
275 0.27
276 0.18
277 0.14
278 0.1
279 0.08
280 0.05
281 0.04
282 0.04
283 0.03
284 0.04
285 0.04
286 0.04
287 0.04
288 0.05
289 0.05
290 0.06
291 0.08
292 0.1
293 0.11
294 0.13
295 0.15
296 0.15
297 0.15
298 0.14
299 0.12
300 0.1
301 0.09
302 0.07
303 0.05
304 0.04
305 0.04
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.05
313 0.06
314 0.06
315 0.07
316 0.07
317 0.08
318 0.08
319 0.09
320 0.09
321 0.1
322 0.13
323 0.2
324 0.26
325 0.34
326 0.35
327 0.38
328 0.4
329 0.39
330 0.37
331 0.33
332 0.28
333 0.2
334 0.19
335 0.16
336 0.15
337 0.14
338 0.13
339 0.09
340 0.08
341 0.07
342 0.06
343 0.05
344 0.04
345 0.05
346 0.06
347 0.07
348 0.08
349 0.1
350 0.11
351 0.1
352 0.11
353 0.11
354 0.1
355 0.1
356 0.11
357 0.1
358 0.1
359 0.12
360 0.12
361 0.12
362 0.13
363 0.15
364 0.15
365 0.15
366 0.15
367 0.17
368 0.19
369 0.18
370 0.22
371 0.21
372 0.2
373 0.26
374 0.26
375 0.24
376 0.22
377 0.22
378 0.2
379 0.18
380 0.19
381 0.14
382 0.19
383 0.22
384 0.22
385 0.21
386 0.19
387 0.19
388 0.18
389 0.17
390 0.16
391 0.12
392 0.12
393 0.12
394 0.12
395 0.11
396 0.11