Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SLF0

Protein Details
Accession A0A1Z5SLF0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-69IEMPDGTIKRRRRKQKPVEEDESKKBasic
NLS Segment(s)
PositionSequence
53-60KRRRRKQK
Subcellular Location(s) E.R. 8, golg 6, mito 5, extr 4, plas 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHYLHPRSRQTGTLFTATLAVSFLVVALPHMLPCPVDRRGYADTIEMPDGTIKRRRRKQKPVEEDESKKEEVLTTVDASRPPRECPVPKPGGLVGQMMGFEKKEPERPSDVVVQALERRRAREEGSQGDTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.32
4 0.26
5 0.21
6 0.15
7 0.11
8 0.07
9 0.06
10 0.06
11 0.04
12 0.04
13 0.04
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.09
21 0.13
22 0.14
23 0.16
24 0.16
25 0.21
26 0.24
27 0.25
28 0.24
29 0.21
30 0.19
31 0.19
32 0.2
33 0.14
34 0.12
35 0.12
36 0.12
37 0.14
38 0.2
39 0.26
40 0.35
41 0.44
42 0.55
43 0.63
44 0.74
45 0.82
46 0.85
47 0.88
48 0.86
49 0.86
50 0.82
51 0.75
52 0.69
53 0.62
54 0.51
55 0.4
56 0.32
57 0.24
58 0.17
59 0.15
60 0.12
61 0.09
62 0.1
63 0.11
64 0.13
65 0.15
66 0.18
67 0.18
68 0.18
69 0.22
70 0.27
71 0.3
72 0.33
73 0.4
74 0.41
75 0.4
76 0.4
77 0.37
78 0.34
79 0.31
80 0.27
81 0.18
82 0.14
83 0.14
84 0.12
85 0.12
86 0.09
87 0.08
88 0.12
89 0.14
90 0.21
91 0.23
92 0.27
93 0.33
94 0.34
95 0.37
96 0.4
97 0.39
98 0.33
99 0.31
100 0.29
101 0.29
102 0.34
103 0.38
104 0.34
105 0.36
106 0.38
107 0.41
108 0.42
109 0.45
110 0.47
111 0.47