Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TEL0

Protein Details
Accession A0A1Z5TEL0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-119DAPKTPKAKATPKKRGKKADADGBasic
128-155GAEDGSPKRKQRKTPVKKGKKAEQAADEBasic
NLS Segment(s)
PositionSequence
100-115KTPKAKATPKKRGKKA
133-148SPKRKQRKTPVKKGKK
Subcellular Location(s) mito 15, cyto 7.5, cyto_nucl 6, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSTKDTTPMGSDAKTSSAAAAAEKKDTTVPTFTEKEDRVMKIAWTCLKSGPPDVDIAKLTKAAGFNTTKTAANTWAVIKKKLLSMGGDGGEGGEAQDAPKTPKAKATPKKRGKKADADGEDDAEAGAGAEDGSPKRKQRKTPVKKGKKAEQAADEDAAAIKGEDTDEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.14
5 0.14
6 0.15
7 0.19
8 0.18
9 0.19
10 0.19
11 0.2
12 0.2
13 0.22
14 0.22
15 0.2
16 0.2
17 0.24
18 0.26
19 0.27
20 0.32
21 0.31
22 0.33
23 0.35
24 0.34
25 0.3
26 0.29
27 0.3
28 0.25
29 0.29
30 0.28
31 0.24
32 0.24
33 0.24
34 0.26
35 0.26
36 0.26
37 0.23
38 0.19
39 0.21
40 0.2
41 0.2
42 0.18
43 0.18
44 0.15
45 0.14
46 0.13
47 0.12
48 0.12
49 0.11
50 0.14
51 0.15
52 0.15
53 0.18
54 0.19
55 0.18
56 0.18
57 0.18
58 0.15
59 0.15
60 0.15
61 0.14
62 0.17
63 0.18
64 0.18
65 0.18
66 0.18
67 0.18
68 0.19
69 0.18
70 0.13
71 0.13
72 0.14
73 0.14
74 0.12
75 0.11
76 0.09
77 0.07
78 0.06
79 0.05
80 0.03
81 0.02
82 0.03
83 0.04
84 0.05
85 0.07
86 0.12
87 0.13
88 0.14
89 0.2
90 0.27
91 0.36
92 0.45
93 0.54
94 0.61
95 0.7
96 0.8
97 0.82
98 0.86
99 0.82
100 0.83
101 0.79
102 0.79
103 0.72
104 0.67
105 0.59
106 0.5
107 0.43
108 0.33
109 0.25
110 0.14
111 0.11
112 0.05
113 0.04
114 0.03
115 0.03
116 0.03
117 0.05
118 0.06
119 0.11
120 0.15
121 0.22
122 0.32
123 0.39
124 0.48
125 0.58
126 0.69
127 0.76
128 0.83
129 0.88
130 0.89
131 0.92
132 0.92
133 0.9
134 0.89
135 0.85
136 0.81
137 0.76
138 0.71
139 0.66
140 0.57
141 0.47
142 0.37
143 0.3
144 0.24
145 0.17
146 0.1
147 0.07
148 0.06
149 0.07