Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5T006

Protein Details
Accession A0A1Z5T006    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65KSEWCNRRKCTDRRGYSAQRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 5, pero 5, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences MPPMPAGAGGAVQGPSTFDKGPIWQADDHATGPLQEVAVSYALNKSEWCNRRKCTDRRGYSAQRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.11
5 0.11
6 0.12
7 0.14
8 0.18
9 0.18
10 0.19
11 0.16
12 0.17
13 0.19
14 0.19
15 0.18
16 0.14
17 0.13
18 0.1
19 0.1
20 0.09
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.05
28 0.06
29 0.07
30 0.07
31 0.08
32 0.1
33 0.19
34 0.26
35 0.31
36 0.38
37 0.41
38 0.51
39 0.61
40 0.66
41 0.68
42 0.72
43 0.75
44 0.75
45 0.82