Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SW42

Protein Details
Accession A0A1Z5SW42   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
59-83TLRKAPQLPRGHRHRHPHRLPQAAEBasic
NLS Segment(s)
PositionSequence
71-71R
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, pero 4
Family & Domain DBs
Amino Acid Sequences MADQMDVDAVKGEQQEEKVGPAPDLPAERIITNNFTLLNAAVDAFDSRFTLRALRSISTLRKAPQLPRGHRHRHPHRLPQAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.15
4 0.18
5 0.2
6 0.2
7 0.19
8 0.17
9 0.17
10 0.16
11 0.17
12 0.16
13 0.14
14 0.14
15 0.14
16 0.15
17 0.15
18 0.15
19 0.14
20 0.14
21 0.11
22 0.1
23 0.1
24 0.09
25 0.08
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.06
37 0.09
38 0.09
39 0.13
40 0.15
41 0.16
42 0.18
43 0.22
44 0.26
45 0.27
46 0.3
47 0.28
48 0.32
49 0.35
50 0.38
51 0.42
52 0.49
53 0.52
54 0.58
55 0.66
56 0.69
57 0.73
58 0.8
59 0.81
60 0.83
61 0.84
62 0.86
63 0.86