Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TB37

Protein Details
Accession A0A1Z5TB37    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
193-226CCTLELYQRVRHQRRCRIHRIKHRWEQRHVLVLRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000675  Cutinase/axe  
IPR011150  Cutinase_monf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0050525  F:cutinase activity  
Pfam View protein in Pfam  
PF01083  Cutinase  
Amino Acid Sequences MKFSANLSYLVYAASVALAVPVEKRASTSYSGGSTATDVADGVCAPVTFIFARGSTETGNMGSTVGPALAKALISALGSDGVAIQGVEYPATIESNISMGSEGGPEMAKLAQQALSNCPDTKIALSGYSQGATVTHYAVKSGGLDAEKVSAVVLYGDPLYGQSVGDLPDSKLKEFCGDIGRWGLRNRNIQHFCCTLELYQRVRHQRRCRIHRIKHRWEQRHVLVLRTIFDRTVLELKQFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.08
9 0.09
10 0.09
11 0.11
12 0.13
13 0.16
14 0.19
15 0.21
16 0.21
17 0.22
18 0.23
19 0.21
20 0.19
21 0.17
22 0.15
23 0.12
24 0.09
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.06
33 0.06
34 0.08
35 0.07
36 0.09
37 0.1
38 0.09
39 0.12
40 0.13
41 0.14
42 0.13
43 0.13
44 0.13
45 0.12
46 0.12
47 0.1
48 0.09
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.04
97 0.05
98 0.07
99 0.09
100 0.1
101 0.11
102 0.14
103 0.15
104 0.15
105 0.15
106 0.13
107 0.12
108 0.12
109 0.11
110 0.08
111 0.08
112 0.08
113 0.1
114 0.1
115 0.09
116 0.09
117 0.08
118 0.07
119 0.07
120 0.08
121 0.06
122 0.08
123 0.07
124 0.07
125 0.08
126 0.08
127 0.07
128 0.07
129 0.08
130 0.06
131 0.07
132 0.07
133 0.08
134 0.07
135 0.07
136 0.07
137 0.05
138 0.04
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.05
149 0.04
150 0.05
151 0.06
152 0.08
153 0.09
154 0.09
155 0.15
156 0.16
157 0.17
158 0.17
159 0.16
160 0.18
161 0.17
162 0.19
163 0.18
164 0.17
165 0.18
166 0.23
167 0.24
168 0.25
169 0.27
170 0.31
171 0.32
172 0.41
173 0.43
174 0.48
175 0.53
176 0.52
177 0.55
178 0.51
179 0.46
180 0.4
181 0.37
182 0.28
183 0.3
184 0.33
185 0.31
186 0.36
187 0.42
188 0.51
189 0.58
190 0.66
191 0.69
192 0.74
193 0.81
194 0.84
195 0.88
196 0.88
197 0.9
198 0.91
199 0.92
200 0.92
201 0.92
202 0.93
203 0.91
204 0.88
205 0.87
206 0.81
207 0.8
208 0.71
209 0.64
210 0.58
211 0.5
212 0.45
213 0.38
214 0.33
215 0.23
216 0.23
217 0.2
218 0.2
219 0.24
220 0.22