Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5STX6

Protein Details
Accession A0A1Z5STX6   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-98QAGRRALRLRSCRKLWRRRWSGRLHydrophilic
NLS Segment(s)
PositionSequence
61-98RRGGRGRVRRKVGWQAGRRALRLRSCRKLWRRRWSGRL
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRPTASTASTRTRHQQPRDNLFAPNLSRRPTARSTPKLDDEVLADPESEAEAAAAHSDNDRRGGRGRVRRKVGWQAGRRALRLRSCRKLWRRRWSGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.68
4 0.74
5 0.77
6 0.71
7 0.63
8 0.55
9 0.52
10 0.45
11 0.43
12 0.37
13 0.32
14 0.33
15 0.33
16 0.36
17 0.37
18 0.42
19 0.44
20 0.48
21 0.52
22 0.54
23 0.57
24 0.53
25 0.49
26 0.4
27 0.32
28 0.27
29 0.22
30 0.17
31 0.13
32 0.11
33 0.1
34 0.1
35 0.07
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.05
44 0.06
45 0.07
46 0.12
47 0.12
48 0.14
49 0.17
50 0.23
51 0.31
52 0.4
53 0.49
54 0.54
55 0.6
56 0.62
57 0.65
58 0.69
59 0.7
60 0.7
61 0.67
62 0.67
63 0.69
64 0.7
65 0.65
66 0.6
67 0.57
68 0.56
69 0.6
70 0.6
71 0.6
72 0.64
73 0.72
74 0.78
75 0.83
76 0.84
77 0.85
78 0.87