Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZBX8

Protein Details
Accession H8ZBX8    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-113SETTPSERRLHRKLHKKCFSPKQNHKBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 12.833, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
Pfam View protein in Pfam  
PF13878  zf-C2H2_3  
Amino Acid Sequences MKTFSRGKAFRINNILDAVPAPVPSPGKTILSFAQARDISQEYAGSKAPEEKEGILRKKTGKKDEKQLVLNLGQKMYTKCHTCGVIYSETTPSERRLHRKLHKKCFSPKQNHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.31
4 0.28
5 0.22
6 0.15
7 0.12
8 0.1
9 0.11
10 0.12
11 0.12
12 0.15
13 0.15
14 0.17
15 0.17
16 0.19
17 0.18
18 0.22
19 0.22
20 0.2
21 0.26
22 0.23
23 0.23
24 0.23
25 0.23
26 0.18
27 0.17
28 0.18
29 0.11
30 0.13
31 0.14
32 0.11
33 0.1
34 0.13
35 0.14
36 0.14
37 0.14
38 0.14
39 0.19
40 0.26
41 0.3
42 0.27
43 0.29
44 0.33
45 0.4
46 0.46
47 0.49
48 0.52
49 0.53
50 0.62
51 0.67
52 0.67
53 0.62
54 0.57
55 0.51
56 0.46
57 0.45
58 0.36
59 0.28
60 0.23
61 0.23
62 0.22
63 0.23
64 0.24
65 0.22
66 0.23
67 0.26
68 0.27
69 0.25
70 0.27
71 0.27
72 0.26
73 0.23
74 0.24
75 0.22
76 0.22
77 0.23
78 0.22
79 0.22
80 0.26
81 0.32
82 0.38
83 0.43
84 0.52
85 0.61
86 0.7
87 0.77
88 0.81
89 0.84
90 0.84
91 0.88
92 0.89
93 0.89