Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5T562

Protein Details
Accession A0A1Z5T562    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPVRKTRKEPTRRSERMELSKAHydrophilic
34-61KIKAPVTPIRKPFRRPKQHKTCRFLQLPHydrophilic
NLS Segment(s)
PositionSequence
5-51RKTRKEPTRRSERMELSKAIEASKKSLKIKIKAPVTPIRKPFRRPKQ
Subcellular Location(s) nucl 11, cyto 11, cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MAPVRKTRKEPTRRSERMELSKAIEASKKSLKIKIKAPVTPIRKPFRRPKQHKTCRFLQLPGELRNQIYRYALVSDKAIEITPTGPGEPPLLSTCVTIRRETKGIYYPENDFRLLLMDYNGAAFSDFYWQSRLWQFRRHSTAKNITFQLGGRPNWANLVEWIKDGYYGCGPPLRPDLDEPKCRDDHVVGAAFRIAEELEFKVCWVTIEKALEAYHWGLKGTCSRWARDGESGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.82
5 0.77
6 0.69
7 0.62
8 0.6
9 0.53
10 0.46
11 0.41
12 0.32
13 0.33
14 0.36
15 0.39
16 0.37
17 0.44
18 0.5
19 0.52
20 0.57
21 0.61
22 0.61
23 0.58
24 0.61
25 0.63
26 0.61
27 0.63
28 0.65
29 0.66
30 0.65
31 0.7
32 0.74
33 0.76
34 0.8
35 0.82
36 0.84
37 0.86
38 0.9
39 0.93
40 0.88
41 0.86
42 0.84
43 0.78
44 0.7
45 0.63
46 0.61
47 0.57
48 0.55
49 0.5
50 0.42
51 0.39
52 0.39
53 0.35
54 0.28
55 0.23
56 0.19
57 0.16
58 0.17
59 0.18
60 0.14
61 0.14
62 0.13
63 0.13
64 0.13
65 0.11
66 0.08
67 0.08
68 0.08
69 0.09
70 0.08
71 0.08
72 0.07
73 0.08
74 0.09
75 0.09
76 0.1
77 0.09
78 0.1
79 0.1
80 0.11
81 0.11
82 0.17
83 0.19
84 0.2
85 0.2
86 0.22
87 0.24
88 0.24
89 0.26
90 0.25
91 0.26
92 0.27
93 0.27
94 0.27
95 0.3
96 0.31
97 0.28
98 0.21
99 0.18
100 0.17
101 0.15
102 0.12
103 0.08
104 0.06
105 0.06
106 0.06
107 0.06
108 0.04
109 0.04
110 0.04
111 0.04
112 0.07
113 0.08
114 0.08
115 0.1
116 0.1
117 0.13
118 0.18
119 0.25
120 0.23
121 0.31
122 0.34
123 0.39
124 0.47
125 0.49
126 0.48
127 0.5
128 0.58
129 0.54
130 0.56
131 0.49
132 0.42
133 0.39
134 0.35
135 0.34
136 0.29
137 0.25
138 0.24
139 0.24
140 0.23
141 0.24
142 0.25
143 0.18
144 0.15
145 0.19
146 0.16
147 0.15
148 0.16
149 0.13
150 0.14
151 0.14
152 0.13
153 0.12
154 0.11
155 0.12
156 0.15
157 0.15
158 0.17
159 0.21
160 0.21
161 0.2
162 0.24
163 0.32
164 0.37
165 0.44
166 0.46
167 0.47
168 0.46
169 0.45
170 0.44
171 0.36
172 0.31
173 0.29
174 0.3
175 0.24
176 0.24
177 0.24
178 0.21
179 0.19
180 0.16
181 0.11
182 0.06
183 0.08
184 0.08
185 0.09
186 0.09
187 0.1
188 0.1
189 0.1
190 0.11
191 0.13
192 0.15
193 0.18
194 0.21
195 0.21
196 0.22
197 0.22
198 0.22
199 0.21
200 0.2
201 0.19
202 0.17
203 0.17
204 0.16
205 0.19
206 0.25
207 0.24
208 0.3
209 0.3
210 0.33
211 0.37
212 0.42
213 0.44