Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Z5TIM5

Protein Details
Accession A0A1Z5TIM5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-74VTKGKGFTKEKNKKKRGSYRGGAIBasic
NLS Segment(s)
PositionSequence
55-68KGFTKEKNKKKRGS
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MPASNETVKQLKKQNVPFSRIPADTKVDPRFSSNDYVPYDYANRAYQDLIVTKGKGFTKEKNKKKRGSYRGGAIDLAPKGIKFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.7
4 0.67
5 0.64
6 0.61
7 0.55
8 0.49
9 0.42
10 0.39
11 0.37
12 0.41
13 0.38
14 0.36
15 0.35
16 0.34
17 0.34
18 0.31
19 0.32
20 0.26
21 0.27
22 0.26
23 0.27
24 0.25
25 0.23
26 0.22
27 0.18
28 0.19
29 0.14
30 0.13
31 0.12
32 0.12
33 0.11
34 0.11
35 0.11
36 0.13
37 0.13
38 0.13
39 0.12
40 0.16
41 0.17
42 0.21
43 0.24
44 0.29
45 0.39
46 0.49
47 0.6
48 0.67
49 0.75
50 0.77
51 0.85
52 0.87
53 0.86
54 0.85
55 0.82
56 0.8
57 0.78
58 0.71
59 0.61
60 0.51
61 0.47
62 0.37
63 0.33
64 0.24
65 0.17