Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SSS3

Protein Details
Accession A0A1Z5SSS3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSRKSKSRSPNPRGRQQQQHQANGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024371  AcetylCoA_trans_1-like  
IPR004752  AmpG_permease/AT-1  
Gene Ontology GO:0016020  C:membrane  
GO:0008521  F:acetyl-CoA transmembrane transporter activity  
Pfam View protein in Pfam  
PF13000  Acatn  
Amino Acid Sequences MPSRKSKSRSPNPRGRQQQQHQANGSTSRAEDSASVTARLMGQSSFTLRRSPSATLDKEEGARIQAKASSNCRNKIGATFYCCVLLYFLQGIPMGLAGGSVPFLLKSYLSYGQIGVYSLGIISLFVEARFGRRKSWILPIQVLSGLRDDLARVTKPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.88
4 0.85
5 0.86
6 0.84
7 0.83
8 0.76
9 0.68
10 0.62
11 0.54
12 0.47
13 0.38
14 0.29
15 0.23
16 0.19
17 0.16
18 0.14
19 0.14
20 0.17
21 0.16
22 0.16
23 0.15
24 0.15
25 0.15
26 0.15
27 0.13
28 0.08
29 0.08
30 0.09
31 0.12
32 0.15
33 0.15
34 0.18
35 0.18
36 0.21
37 0.22
38 0.23
39 0.26
40 0.3
41 0.31
42 0.31
43 0.32
44 0.3
45 0.28
46 0.27
47 0.21
48 0.15
49 0.16
50 0.13
51 0.12
52 0.14
53 0.15
54 0.19
55 0.24
56 0.31
57 0.34
58 0.36
59 0.38
60 0.36
61 0.34
62 0.32
63 0.33
64 0.26
65 0.25
66 0.23
67 0.22
68 0.22
69 0.21
70 0.18
71 0.14
72 0.11
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.04
82 0.03
83 0.03
84 0.02
85 0.02
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.05
94 0.09
95 0.12
96 0.13
97 0.14
98 0.13
99 0.14
100 0.14
101 0.13
102 0.1
103 0.07
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.07
114 0.07
115 0.12
116 0.2
117 0.2
118 0.22
119 0.27
120 0.31
121 0.33
122 0.43
123 0.45
124 0.43
125 0.47
126 0.46
127 0.43
128 0.42
129 0.39
130 0.3
131 0.25
132 0.2
133 0.15
134 0.14
135 0.12
136 0.13
137 0.17
138 0.2