Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5TV05

Protein Details
Accession A0A1Z5TV05    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
126-145TPSGSGKKRGRKPKGYEVGGBasic
NLS Segment(s)
PositionSequence
130-139SGKKRGRKPK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MVREPTFNSLKSTTRSQHPAATTSNMPLSQKQMEYLALAWQCFETEPKIDYNKFYRVANLASAASARELMRVTKKKLKEEYGALGDAGGNGGNPGTPNANTNTPKKAGKATTGRNGGLSASAATGTPSGSGKKRGRKPKGYEVGGGGEDVDDGEEEEGCPLKKKGKMTGDGVEIKREKSFEEEIDEESILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.48
4 0.5
5 0.49
6 0.48
7 0.44
8 0.43
9 0.37
10 0.33
11 0.33
12 0.29
13 0.28
14 0.26
15 0.27
16 0.27
17 0.26
18 0.24
19 0.22
20 0.21
21 0.21
22 0.19
23 0.2
24 0.17
25 0.16
26 0.15
27 0.14
28 0.13
29 0.13
30 0.13
31 0.1
32 0.11
33 0.13
34 0.16
35 0.21
36 0.22
37 0.26
38 0.29
39 0.33
40 0.32
41 0.31
42 0.3
43 0.27
44 0.27
45 0.24
46 0.21
47 0.15
48 0.13
49 0.13
50 0.11
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.11
57 0.2
58 0.25
59 0.3
60 0.36
61 0.4
62 0.46
63 0.52
64 0.54
65 0.49
66 0.47
67 0.46
68 0.41
69 0.37
70 0.3
71 0.24
72 0.19
73 0.14
74 0.11
75 0.06
76 0.03
77 0.02
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.06
85 0.09
86 0.14
87 0.17
88 0.2
89 0.23
90 0.24
91 0.26
92 0.26
93 0.29
94 0.25
95 0.29
96 0.34
97 0.36
98 0.41
99 0.44
100 0.42
101 0.38
102 0.36
103 0.29
104 0.22
105 0.17
106 0.09
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.09
116 0.11
117 0.21
118 0.27
119 0.37
120 0.46
121 0.56
122 0.65
123 0.72
124 0.78
125 0.8
126 0.83
127 0.77
128 0.7
129 0.62
130 0.55
131 0.45
132 0.36
133 0.25
134 0.15
135 0.12
136 0.09
137 0.07
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.08
145 0.08
146 0.11
147 0.12
148 0.19
149 0.23
150 0.27
151 0.36
152 0.43
153 0.48
154 0.51
155 0.55
156 0.55
157 0.6
158 0.56
159 0.55
160 0.49
161 0.44
162 0.41
163 0.36
164 0.3
165 0.28
166 0.31
167 0.25
168 0.3
169 0.31
170 0.3
171 0.33