Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZBQ8

Protein Details
Accession H8ZBQ8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-75ETRTQQPCMHRGKKRQSRGRSRAIWGHydrophilic
NLS Segment(s)
PositionSequence
62-68KKRQSRG
Subcellular Location(s) nucl 11, mito 10, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd00600  Sm_like  
Amino Acid Sequences MESGFPTEALHTHLEKGNTLTVLVKKDRSVRGTLSLIDKHMNLLLQDAVETRTQQPCMHRGKKRQSRGRSRAIWGMYLFEGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.22
5 0.18
6 0.18
7 0.18
8 0.18
9 0.22
10 0.23
11 0.23
12 0.23
13 0.29
14 0.34
15 0.33
16 0.33
17 0.3
18 0.33
19 0.33
20 0.32
21 0.29
22 0.25
23 0.23
24 0.21
25 0.19
26 0.15
27 0.14
28 0.12
29 0.08
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.09
38 0.1
39 0.13
40 0.15
41 0.17
42 0.2
43 0.26
44 0.35
45 0.43
46 0.49
47 0.56
48 0.66
49 0.74
50 0.81
51 0.84
52 0.85
53 0.87
54 0.88
55 0.88
56 0.83
57 0.78
58 0.75
59 0.67
60 0.6
61 0.49
62 0.44
63 0.34