Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZC41

Protein Details
Accession H8ZC41    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
36-55SMEKRKARLGRKTRTPNKPNBasic
NLS Segment(s)
PositionSequence
39-49KRKARLGRKTR
Subcellular Location(s) extr 10, mito 5, E.R. 4, mito_nucl 4, nucl 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKASSRSKLPKALKVIAVILFVIAALLKISVILDISMEKRKARLGRKTRTPNKPNVNQNNGLVTEAERPLLLVTRLSNENLNDCNSDAEPNPRKHTQETLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.41
4 0.35
5 0.27
6 0.19
7 0.13
8 0.1
9 0.08
10 0.05
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.05
22 0.08
23 0.12
24 0.14
25 0.14
26 0.15
27 0.2
28 0.26
29 0.33
30 0.41
31 0.46
32 0.54
33 0.64
34 0.74
35 0.78
36 0.82
37 0.8
38 0.78
39 0.77
40 0.77
41 0.77
42 0.75
43 0.71
44 0.63
45 0.59
46 0.52
47 0.44
48 0.36
49 0.26
50 0.19
51 0.16
52 0.13
53 0.12
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.08
60 0.08
61 0.12
62 0.14
63 0.15
64 0.17
65 0.17
66 0.2
67 0.2
68 0.22
69 0.2
70 0.19
71 0.2
72 0.18
73 0.2
74 0.18
75 0.26
76 0.33
77 0.37
78 0.43
79 0.46
80 0.5
81 0.51