Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZA52

Protein Details
Accession H8ZA52    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-89NETTWKEYLNKQKKLREKNVKIKKRRKBasic
NLS Segment(s)
PositionSequence
73-89KQKKLREKNVKIKKRRK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MEKFPTDEDASSDGFEIVLHDTEDAPALNSDLLHTYTVEYDGTDKPWNKPGEDITDYFNYGFNETTWKEYLNKQKKLREKNVKIKKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.09
11 0.08
12 0.07
13 0.06
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.08
26 0.07
27 0.08
28 0.08
29 0.1
30 0.14
31 0.15
32 0.16
33 0.23
34 0.24
35 0.22
36 0.24
37 0.24
38 0.26
39 0.28
40 0.27
41 0.24
42 0.24
43 0.24
44 0.22
45 0.22
46 0.16
47 0.14
48 0.14
49 0.1
50 0.14
51 0.15
52 0.18
53 0.17
54 0.18
55 0.2
56 0.27
57 0.38
58 0.43
59 0.51
60 0.55
61 0.63
62 0.72
63 0.8
64 0.84
65 0.84
66 0.85
67 0.87
68 0.9
69 0.92