Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5T6B0

Protein Details
Accession A0A1Z5T6B0   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-107QTRSCQQTRARTFKRCRSRRLTRANKRRTDSRPVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MQSFLRIIPSRALQAPYVQRPATRAFSCAPQLRLKEDKEQSPEQVEKAKQEQMKGNKNARTNSRLAQRLPSTQTRSCQQTRARTFKRCRSRRLTRANKRRTDSRPVDETQCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.38
4 0.41
5 0.38
6 0.35
7 0.36
8 0.4
9 0.4
10 0.33
11 0.3
12 0.26
13 0.3
14 0.36
15 0.37
16 0.36
17 0.34
18 0.35
19 0.38
20 0.42
21 0.41
22 0.43
23 0.43
24 0.44
25 0.45
26 0.46
27 0.42
28 0.41
29 0.4
30 0.32
31 0.34
32 0.29
33 0.26
34 0.27
35 0.3
36 0.27
37 0.28
38 0.34
39 0.36
40 0.44
41 0.47
42 0.51
43 0.5
44 0.52
45 0.54
46 0.52
47 0.48
48 0.42
49 0.4
50 0.41
51 0.4
52 0.37
53 0.39
54 0.37
55 0.37
56 0.39
57 0.41
58 0.4
59 0.38
60 0.41
61 0.39
62 0.43
63 0.41
64 0.44
65 0.45
66 0.49
67 0.55
68 0.62
69 0.65
70 0.69
71 0.75
72 0.78
73 0.82
74 0.8
75 0.8
76 0.8
77 0.84
78 0.84
79 0.87
80 0.88
81 0.88
82 0.91
83 0.92
84 0.91
85 0.87
86 0.86
87 0.81
88 0.81
89 0.78
90 0.75
91 0.72
92 0.67