Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5SQL7

Protein Details
Accession A0A1Z5SQL7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-30GPTYRRRCGLKGGPKKNQKITKKFVINHydrophilic
88-107YLKYLTKKFLKKQQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MVAGPTYRRRCGLKGGPKKNQKITKKFVINATQPTQDRIFDPSAFATFLQQRIKVDGLTGNLGDTINVSNLGDGRIEVVAHKEFSGRYLKYLTKKFLKKQQLRDWLRVVSTNKGEYTLKFFNVVGDEGEEEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.75
4 0.81
5 0.86
6 0.86
7 0.86
8 0.85
9 0.84
10 0.81
11 0.81
12 0.79
13 0.74
14 0.72
15 0.7
16 0.65
17 0.62
18 0.58
19 0.54
20 0.47
21 0.46
22 0.4
23 0.33
24 0.29
25 0.27
26 0.26
27 0.19
28 0.2
29 0.17
30 0.17
31 0.16
32 0.15
33 0.14
34 0.13
35 0.17
36 0.18
37 0.19
38 0.18
39 0.2
40 0.21
41 0.18
42 0.16
43 0.14
44 0.13
45 0.12
46 0.12
47 0.09
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.04
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.11
72 0.18
73 0.15
74 0.16
75 0.2
76 0.24
77 0.31
78 0.36
79 0.41
80 0.44
81 0.51
82 0.56
83 0.62
84 0.68
85 0.7
86 0.75
87 0.78
88 0.8
89 0.79
90 0.78
91 0.72
92 0.64
93 0.57
94 0.53
95 0.45
96 0.41
97 0.4
98 0.37
99 0.32
100 0.33
101 0.33
102 0.28
103 0.33
104 0.3
105 0.27
106 0.26
107 0.25
108 0.25
109 0.25
110 0.25
111 0.18
112 0.16
113 0.15