Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5T8V1

Protein Details
Accession A0A1Z5T8V1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
348-374AFTVSRRKFEIRPRRRRRSSSGAGIPSHydrophilic
NLS Segment(s)
PositionSequence
353-366RRKFEIRPRRRRRS
Subcellular Location(s) nucl 10, cyto_nucl 10, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR008728  Elongator_complex_protein_4  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0033588  C:elongator holoenzyme complex  
GO:0005634  C:nucleus  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF05625  PAXNEB  
CDD cd19494  Elp4  
Amino Acid Sequences MAFRKRNVAVGKGSGGDADGVPATVQTGVRPSSLTSSHPVISTGSSSLDEILGGHAGLALGSSLLIEESGTTDFSGALLKYYAAEGICHGHAVHVVGMGDGWIRDLPAAAEEKGSRRSSASSSSGSEDKMKIAWRYEKLGQTGDRAPPSPRSHPDQNDPNAPQIPFCHTFDLTKRLTIPPTARINHIPLKSPTKPFESIIPSLDQAIQTLPPGTLHRLVIPTVLSPALWPPTASRPENFLHFLHSLQALLQKHPTRLTAMLTLPLELQPRSSGLTRWAELFSDGVLELTPFPHLMDASRSSGLAESGGARAGKDEQPQGMLKVHKLPITTARGEGGAGPGNTIGEDLAFTVSRRKFEIRPRRRRRSSSGAGIPSAAPVAALLEPDGADFVPETGGKGEEGEEEGEEDAEEDGEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.2
4 0.15
5 0.12
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.13
15 0.14
16 0.15
17 0.16
18 0.16
19 0.19
20 0.21
21 0.23
22 0.23
23 0.26
24 0.27
25 0.27
26 0.26
27 0.22
28 0.22
29 0.21
30 0.17
31 0.15
32 0.14
33 0.14
34 0.13
35 0.12
36 0.11
37 0.09
38 0.09
39 0.08
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.05
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.1
70 0.08
71 0.08
72 0.08
73 0.11
74 0.11
75 0.11
76 0.11
77 0.1
78 0.1
79 0.11
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.07
87 0.05
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.07
95 0.1
96 0.09
97 0.11
98 0.13
99 0.16
100 0.22
101 0.23
102 0.22
103 0.21
104 0.23
105 0.24
106 0.28
107 0.29
108 0.25
109 0.25
110 0.28
111 0.28
112 0.26
113 0.27
114 0.22
115 0.19
116 0.19
117 0.2
118 0.2
119 0.23
120 0.29
121 0.28
122 0.33
123 0.37
124 0.39
125 0.38
126 0.4
127 0.36
128 0.33
129 0.36
130 0.34
131 0.31
132 0.28
133 0.28
134 0.32
135 0.36
136 0.38
137 0.37
138 0.41
139 0.47
140 0.5
141 0.56
142 0.56
143 0.55
144 0.56
145 0.53
146 0.49
147 0.44
148 0.4
149 0.33
150 0.26
151 0.28
152 0.24
153 0.24
154 0.23
155 0.2
156 0.23
157 0.25
158 0.3
159 0.24
160 0.22
161 0.23
162 0.22
163 0.23
164 0.24
165 0.24
166 0.25
167 0.31
168 0.31
169 0.31
170 0.31
171 0.35
172 0.37
173 0.36
174 0.33
175 0.3
176 0.36
177 0.37
178 0.39
179 0.38
180 0.36
181 0.37
182 0.33
183 0.35
184 0.33
185 0.3
186 0.27
187 0.25
188 0.21
189 0.2
190 0.2
191 0.14
192 0.1
193 0.09
194 0.07
195 0.06
196 0.07
197 0.06
198 0.06
199 0.07
200 0.09
201 0.1
202 0.1
203 0.11
204 0.12
205 0.12
206 0.12
207 0.11
208 0.09
209 0.08
210 0.08
211 0.06
212 0.06
213 0.07
214 0.08
215 0.07
216 0.08
217 0.08
218 0.15
219 0.2
220 0.21
221 0.21
222 0.23
223 0.24
224 0.27
225 0.28
226 0.22
227 0.21
228 0.21
229 0.2
230 0.17
231 0.16
232 0.14
233 0.11
234 0.16
235 0.13
236 0.14
237 0.2
238 0.21
239 0.22
240 0.23
241 0.24
242 0.21
243 0.21
244 0.22
245 0.2
246 0.18
247 0.2
248 0.18
249 0.18
250 0.16
251 0.16
252 0.16
253 0.12
254 0.13
255 0.1
256 0.1
257 0.12
258 0.12
259 0.12
260 0.16
261 0.2
262 0.2
263 0.21
264 0.21
265 0.19
266 0.18
267 0.18
268 0.12
269 0.09
270 0.08
271 0.06
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.05
278 0.05
279 0.06
280 0.06
281 0.07
282 0.1
283 0.13
284 0.16
285 0.16
286 0.16
287 0.16
288 0.16
289 0.15
290 0.11
291 0.09
292 0.07
293 0.07
294 0.09
295 0.09
296 0.08
297 0.09
298 0.13
299 0.16
300 0.18
301 0.2
302 0.19
303 0.23
304 0.24
305 0.25
306 0.26
307 0.25
308 0.23
309 0.28
310 0.3
311 0.29
312 0.28
313 0.29
314 0.32
315 0.36
316 0.35
317 0.29
318 0.27
319 0.25
320 0.25
321 0.23
322 0.17
323 0.15
324 0.14
325 0.13
326 0.12
327 0.12
328 0.12
329 0.11
330 0.09
331 0.04
332 0.05
333 0.05
334 0.06
335 0.07
336 0.07
337 0.16
338 0.18
339 0.2
340 0.24
341 0.28
342 0.33
343 0.44
344 0.55
345 0.58
346 0.67
347 0.77
348 0.84
349 0.9
350 0.91
351 0.89
352 0.88
353 0.86
354 0.85
355 0.83
356 0.76
357 0.67
358 0.6
359 0.51
360 0.41
361 0.32
362 0.21
363 0.12
364 0.07
365 0.08
366 0.07
367 0.07
368 0.07
369 0.07
370 0.07
371 0.08
372 0.09
373 0.06
374 0.06
375 0.06
376 0.06
377 0.08
378 0.08
379 0.09
380 0.1
381 0.11
382 0.1
383 0.11
384 0.11
385 0.11
386 0.13
387 0.13
388 0.12
389 0.12
390 0.12
391 0.12
392 0.1
393 0.1
394 0.08
395 0.07