Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZCS3

Protein Details
Accession H8ZCS3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
66-109FTCLANRDTKPSKKRKNKKARKPRRRPVKNIKFKSRRFKRDDFIBasic
NLS Segment(s)
PositionSequence
75-105KPSKKRKNKKARKPRRRPVKNIKFKSRRFKR
Subcellular Location(s) extr 10, nucl 3, pero 3, E.R. 3, golg 3, plas 2, cyto_nucl 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
Amino Acid Sequences MIITAYTVLILSLYLGAAHAEVCYDRRSNILQGKTDEIYLDSANFRNWPRDENGVQNIDNTCPIGFTCLANRDTKPSKKRKNKKARKPRRRPVKNIKFKSRRFKRDDFIDKGCLGLEKYEEVGLQSALNNLYMGACKQCIGNDAAKYKTLAMVYTTFNNDEAKWKFIALNGKCTIKNVHTGMYMSKCDNCAPMALNTPMVALFREEIDDNTNDEVWTVTRKVDGDYVFQSASNGGYLGICKDCLSEKTTMNMPAATLDTVHDSPSVAWSVRIDEETESYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.08
10 0.12
11 0.13
12 0.13
13 0.16
14 0.2
15 0.27
16 0.34
17 0.38
18 0.39
19 0.41
20 0.45
21 0.43
22 0.4
23 0.33
24 0.26
25 0.22
26 0.18
27 0.16
28 0.14
29 0.14
30 0.15
31 0.18
32 0.19
33 0.24
34 0.25
35 0.27
36 0.29
37 0.35
38 0.36
39 0.39
40 0.44
41 0.4
42 0.39
43 0.38
44 0.35
45 0.29
46 0.27
47 0.21
48 0.15
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.15
55 0.19
56 0.21
57 0.24
58 0.24
59 0.29
60 0.36
61 0.44
62 0.5
63 0.56
64 0.65
65 0.73
66 0.84
67 0.87
68 0.91
69 0.93
70 0.94
71 0.95
72 0.95
73 0.96
74 0.97
75 0.96
76 0.96
77 0.95
78 0.94
79 0.94
80 0.94
81 0.93
82 0.92
83 0.92
84 0.91
85 0.89
86 0.89
87 0.88
88 0.87
89 0.84
90 0.81
91 0.77
92 0.77
93 0.78
94 0.72
95 0.66
96 0.59
97 0.51
98 0.44
99 0.38
100 0.28
101 0.19
102 0.14
103 0.1
104 0.07
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.07
127 0.09
128 0.12
129 0.15
130 0.17
131 0.18
132 0.18
133 0.18
134 0.17
135 0.16
136 0.13
137 0.11
138 0.1
139 0.11
140 0.12
141 0.13
142 0.14
143 0.12
144 0.13
145 0.13
146 0.12
147 0.16
148 0.17
149 0.17
150 0.16
151 0.16
152 0.16
153 0.18
154 0.27
155 0.22
156 0.28
157 0.28
158 0.31
159 0.31
160 0.32
161 0.32
162 0.24
163 0.29
164 0.23
165 0.22
166 0.2
167 0.21
168 0.23
169 0.23
170 0.24
171 0.19
172 0.19
173 0.18
174 0.18
175 0.18
176 0.15
177 0.13
178 0.13
179 0.14
180 0.16
181 0.16
182 0.16
183 0.14
184 0.14
185 0.13
186 0.12
187 0.1
188 0.07
189 0.07
190 0.07
191 0.08
192 0.08
193 0.09
194 0.12
195 0.13
196 0.13
197 0.14
198 0.14
199 0.13
200 0.12
201 0.12
202 0.1
203 0.12
204 0.11
205 0.11
206 0.12
207 0.13
208 0.15
209 0.19
210 0.19
211 0.2
212 0.21
213 0.23
214 0.21
215 0.2
216 0.19
217 0.15
218 0.14
219 0.1
220 0.09
221 0.06
222 0.06
223 0.07
224 0.09
225 0.09
226 0.09
227 0.09
228 0.1
229 0.13
230 0.15
231 0.18
232 0.2
233 0.21
234 0.25
235 0.29
236 0.31
237 0.29
238 0.27
239 0.24
240 0.21
241 0.21
242 0.18
243 0.14
244 0.12
245 0.16
246 0.16
247 0.16
248 0.15
249 0.14
250 0.14
251 0.16
252 0.18
253 0.13
254 0.14
255 0.14
256 0.18
257 0.19
258 0.2
259 0.18
260 0.17