Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H8ZAX7

Protein Details
Accession H8ZAX7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-36IFAQKPKDIKPNRKTKTKKEKPYEVRGSSHydrophilic
NLS Segment(s)
PositionSequence
13-28PKDIKPNRKTKTKKEK
Subcellular Location(s) cyto_nucl 15.5, nucl 15, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MASPIDDIFAQKPKDIKPNRKTKTKKEKPYEVRGSSALEQDIFSCDGYKIYTQEELKIGRGGNTPNCPIDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.54
4 0.57
5 0.67
6 0.72
7 0.78
8 0.82
9 0.83
10 0.85
11 0.85
12 0.86
13 0.84
14 0.88
15 0.85
16 0.88
17 0.86
18 0.77
19 0.68
20 0.59
21 0.53
22 0.43
23 0.36
24 0.25
25 0.16
26 0.14
27 0.11
28 0.12
29 0.09
30 0.08
31 0.08
32 0.07
33 0.08
34 0.09
35 0.1
36 0.09
37 0.1
38 0.16
39 0.16
40 0.18
41 0.21
42 0.21
43 0.22
44 0.24
45 0.22
46 0.2
47 0.22
48 0.25
49 0.28
50 0.32
51 0.33
52 0.34
53 0.35
54 0.35
55 0.34