Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Z5T2M3

Protein Details
Accession A0A1Z5T2M3   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSSRSSRVKKNNQNLKKKLFGPHydrophilic
87-123PSGSWRLERNEKQKKQKAARVQKSTGHRKERNKIVFGHydrophilic
NLS Segment(s)
PositionSequence
85-133AKPSGSWRLERNEKQKKQKAARVQKSTGHRKERNKIVFGKTGKAKSKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSRVKKNNQNLKKKLFGPAEIARSERMNAKLLELAQQQKSQQEMEVEGSDDKDGVANKSEDKDAEDDAEMDVDGSAAKAKPSGSWRLERNEKQKKQKAARVQKSTGHRKERNKIVFGKTGKAKSKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.9
4 0.87
5 0.83
6 0.75
7 0.73
8 0.66
9 0.58
10 0.54
11 0.51
12 0.49
13 0.43
14 0.41
15 0.34
16 0.31
17 0.3
18 0.27
19 0.24
20 0.22
21 0.21
22 0.21
23 0.22
24 0.21
25 0.25
26 0.24
27 0.26
28 0.25
29 0.27
30 0.26
31 0.25
32 0.27
33 0.22
34 0.2
35 0.16
36 0.15
37 0.15
38 0.14
39 0.13
40 0.12
41 0.12
42 0.1
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.1
51 0.11
52 0.11
53 0.1
54 0.11
55 0.12
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.08
62 0.06
63 0.05
64 0.05
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.09
74 0.13
75 0.21
76 0.24
77 0.3
78 0.34
79 0.41
80 0.5
81 0.54
82 0.61
83 0.65
84 0.7
85 0.75
86 0.79
87 0.82
88 0.82
89 0.83
90 0.83
91 0.83
92 0.85
93 0.83
94 0.79
95 0.76
96 0.77
97 0.79
98 0.78
99 0.77
100 0.75
101 0.76
102 0.81
103 0.85
104 0.83
105 0.79
106 0.77
107 0.73
108 0.73
109 0.66
110 0.65
111 0.62
112 0.63
113 0.66