Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H8ZG33

Protein Details
Accession H8ZG33    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-103IEKINKIREKKQREKEDWKRKFNHRTKKGQIPLGPBasic
NLS Segment(s)
PositionSequence
61-98KREERQNEIEKINKIREKKQREKEDWKRKFNHRTKKGQ
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MVWKSQTQYRKQKEEEMTDRRRDEDMRKAFADENIEHLPNVSSKTKKQSVLEDIHKENLRKREERQNEIEKINKIREKKQREKEDWKRKFNHRTKKGQIPLGPRINYLYKKIQELKKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.74
4 0.73
5 0.72
6 0.7
7 0.62
8 0.58
9 0.52
10 0.48
11 0.48
12 0.47
13 0.44
14 0.43
15 0.43
16 0.41
17 0.39
18 0.39
19 0.29
20 0.27
21 0.25
22 0.24
23 0.21
24 0.21
25 0.19
26 0.15
27 0.18
28 0.17
29 0.17
30 0.2
31 0.28
32 0.33
33 0.36
34 0.37
35 0.4
36 0.42
37 0.46
38 0.49
39 0.46
40 0.42
41 0.43
42 0.43
43 0.39
44 0.37
45 0.37
46 0.36
47 0.34
48 0.37
49 0.42
50 0.47
51 0.51
52 0.54
53 0.55
54 0.54
55 0.53
56 0.54
57 0.47
58 0.44
59 0.45
60 0.42
61 0.38
62 0.43
63 0.5
64 0.55
65 0.62
66 0.69
67 0.73
68 0.78
69 0.85
70 0.88
71 0.89
72 0.89
73 0.88
74 0.86
75 0.85
76 0.87
77 0.86
78 0.86
79 0.84
80 0.85
81 0.84
82 0.86
83 0.84
84 0.81
85 0.77
86 0.74
87 0.74
88 0.72
89 0.65
90 0.55
91 0.52
92 0.51
93 0.49
94 0.46
95 0.46
96 0.4
97 0.47
98 0.55
99 0.59